Recombinant Full Length Human UBE2D2 Protein
Cat.No. : | UBE2D2-67H |
Product Overview : | Recombinant human UBE2D2 protein (1-147aa) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-147 a.a. |
Description : | Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene. |
Form : | Liquid |
Molecular Mass : | 16.7 kDa |
AA Sequence : | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM |
Purity : | > 95% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5mg/mL |
Storage Buffer : | In 20mM MES (pH6.0) containing 50mM NaCl, 1mM DTT |
Gene Name | UBE2D2 ubiquitin conjugating enzyme E2 D2 [ Homo sapiens (human) ] |
Official Symbol | UBE2D2 |
Synonyms | UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2; ubiquitin-conjugating enzyme E2 D2; (E3-independent) E2 ubiquitin-conjugating enzyme D2; E2 ubiquitin-conjugating enzyme D2; p53-regulated ubiquitin-conjugating enzyme 1; ubiquitin carrier protein D2; ubiquitin conjugating enzyme E2D 2; ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); ubiquitin-protein ligase D2; EC 2.3.2.23; EC 2.3.2.24 |
Gene ID | 7322 |
mRNA Refseq | NM_003339 |
Protein Refseq | NP_003330 |
MIM | 602962 |
UniProt ID | P62837 |
◆ Recombinant Proteins | ||
UBE2D2-6396R | Recombinant Rat UBE2D2 Protein | +Inquiry |
UBE2D2-6315H | Recombinant Human UBE2D2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UBE2D2-7405H | Recombinant Human UBE2D2 protein, His-tagged | +Inquiry |
UBE2D2-30042TH | Recombinant Human UBE2D2 | +Inquiry |
UBE2D2-71H | Recombinant Full Length Human UBE2D2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2D2-587HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
UBE2D2-588HCL | Recombinant Human UBE2D2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2D2 Products
Required fields are marked with *
My Review for All UBE2D2 Products
Required fields are marked with *