Recombinant Full Length Human UBE2D2 Protein

Cat.No. : UBE2D2-67H
Product Overview : Recombinant human UBE2D2 protein (1-147aa) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 1-147 a.a.
Description : Regulated degradation of misfolded, damaged or short-lived proteins in eukaryotes occurs via the ubiquitin (Ub)-proteasome system (UPS). An integral part of the UPS system is the ubiquitination of target proteins and covalent linkage of Ub-containing proteins to form polymeric chains, marking them as targets for 26S proteasome-mediated degradation. Ubiquitination of proteins is mediated by a cascade of enzymes which includes E1 (ubiquitin activating), E2 (ubiquitin conjugating), and E3 (ubiquitin ligases) enzymes. This gene encodes a member of the E2 enzyme family. Substrates of this enzyme include the tumor suppressor protein p53 and peroxisomal biogenesis factor 5 (PEX5). Alternative splicing results in multiple transcript variants of this gene.
Form : Liquid
Molecular Mass : 16.7 kDa
AA Sequence : MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNRIAREWTQKYAM
Purity : > 95% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5mg/mL
Storage Buffer : In 20mM MES (pH6.0) containing 50mM NaCl, 1mM DTT
Gene Name UBE2D2 ubiquitin conjugating enzyme E2 D2 [ Homo sapiens (human) ]
Official Symbol UBE2D2
Synonyms UBC4; PUBC1; UBCH4; UBC4/5; UBCH5B; E2(17)KB2; ubiquitin-conjugating enzyme E2 D2; (E3-independent) E2 ubiquitin-conjugating enzyme D2; E2 ubiquitin-conjugating enzyme D2; p53-regulated ubiquitin-conjugating enzyme 1; ubiquitin carrier protein D2; ubiquitin conjugating enzyme E2D 2; ubiquitin-conjugating enzyme E2-17 kDa 2; ubiquitin-conjugating enzyme E2D 2 (homologous to yeast UBC4/5); ubiquitin-protein ligase D2; EC 2.3.2.23; EC 2.3.2.24
Gene ID 7322
mRNA Refseq NM_003339
Protein Refseq NP_003330
MIM 602962
UniProt ID P62837

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2D2 Products

Required fields are marked with *

My Review for All UBE2D2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon