Recombinant Full Length Human UBE2V1 Protein, C-Flag-tagged
Cat.No. : | UBE2V1-819HFL |
Product Overview : | Recombinant Full Length Human UBE2V1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene is located in the nucleus and can cause transcriptional activation of the human FOS proto-oncogene. It is thought to be involved in the control of differentiation by altering cell cycle behavior. Alternatively spliced transcript variants encoding multiple isoforms have been described for this gene, and multiple pseudogenes of this gene have been identified. Co-transcription of this gene and the neighboring upstream gene generates a rare transcript (Kua-UEV), which encodes a fusion protein comprised of sequence sharing identity with each individual gene product. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 42 kDa |
AA Sequence : | MAGAEDWPGQQLELDEDEASCCRWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARW EDTPLVILGVVAGALIADFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNC LVTLLPLLNMAYKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILP RKHHRIHHVSPHETYFCITTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPR TIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLAKWQNSYSIKVVLQELRRL MMSKENMKLPQPPEGQCYSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | UBE2V1 ubiquitin conjugating enzyme E2 V1 [ Homo sapiens (human) ] |
Official Symbol | UBE2V1 |
Synonyms | CIR1; UEV1; CROC1; UBE2V; UEV-1; UEV1A; CROC-1 |
Gene ID | 7335 |
mRNA Refseq | NM_199144.3 |
Protein Refseq | NP_954595.1 |
MIM | 602995 |
UniProt ID | Q13404 |
◆ Recombinant Proteins | ||
UBE2V1-4508C | Recombinant Chicken UBE2V1 | +Inquiry |
Ube2v1-6800M | Recombinant Mouse Ube2v1 Protein, Myc/DDK-tagged | +Inquiry |
UBE2V1-0520H | Recombinant Human UBE2V1 Protein (A2-N147), His/Strep tagged | +Inquiry |
UBE2V1-2298H | Recombinant Human UBE2V1 Protein, His (Fc)-Avi-tagged | +Inquiry |
UBE2V1-109H | Recombinant Human UBE2V1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2V1-560HCL | Recombinant Human UBE2V1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UBE2V1 Products
Required fields are marked with *
My Review for All UBE2V1 Products
Required fields are marked with *
0
Inquiry Basket