Recombinant Full Length Human Ubiquitin-Associated Domain-Containing Protein 2(Ubac2) Protein, His-Tagged
| Cat.No. : | RFL29854HF |
| Product Overview : | Recombinant Full Length Human Ubiquitin-associated domain-containing protein 2(UBAC2) Protein (Q8NBM4) (36-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (36-344) |
| Form : | Lyophilized powder |
| AA Sequence : | HCQKLFVYDLHAVKNDFQIWRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASF LLGSWVLSALFDFLLIEAMQYFFGITAASNLPSGFLAPVFALFVPFYCSIPRVQVAQILG PLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGLCYDSKMFQVHQVLCIPSWMAKFFS WTLEPIFSSSEPTSEARIGMGATLDIQRQQRMELLDRQLMFSQFAQGRRQRQQQGGMINW NRLFPPLRQRQNVNYQGGRQSEPAAPPLEVSEEQVARLMEMGFSRGDALEALRASNNDLN VATNFLLQH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | UBAC2 |
| Synonyms | UBAC2; PHGDHL1; PSEC0110; Ubiquitin-associated domain-containing protein 2; UBA domain-containing protein 2; Phosphoglycerate dehydrogenase-like protein 1 |
| UniProt ID | Q8NBM4 |
| ◆ Recombinant Proteins | ||
| UBAC2-1070C | Recombinant Cynomolgus UBAC2 Protein, His-tagged | +Inquiry |
| UBAC2-1415C | Recombinant Chicken UBAC2 | +Inquiry |
| UBAC2-17695M | Recombinant Mouse UBAC2 Protein | +Inquiry |
| RFL29854HF | Recombinant Full Length Human Ubiquitin-Associated Domain-Containing Protein 2(Ubac2) Protein, His-Tagged | +Inquiry |
| RFL14942MF | Recombinant Full Length Mouse Ubiquitin-Associated Domain-Containing Protein 2(Ubac2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBAC2 Products
Required fields are marked with *
My Review for All UBAC2 Products
Required fields are marked with *
