Recombinant Full Length Human UCHL3 Protein, C-Flag-tagged
Cat.No. : | UCHL3-1197HFL |
Product Overview : | Recombinant Full Length Human UCHL3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 26 kDa |
AA Sequence : | MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEE EKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLEN YDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCK KFMERDPDELRFNAIALSAATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | UCHL3 ubiquitin C-terminal hydrolase L3 [ Homo sapiens (human) ] |
Official Symbol | UCHL3 |
Synonyms | UCH-L3 |
Gene ID | 7347 |
mRNA Refseq | NM_006002.5 |
Protein Refseq | NP_005993.1 |
MIM | 603090 |
UniProt ID | P15374 |
◆ Recombinant Proteins | ||
UCHL3-2748H | Recombinant Human UCHL3 protein, His-tagged | +Inquiry |
UCHL3-4899R | Recombinant Rhesus Macaque UCHL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCHL3-180H | Active Recombinant Full Length Human UCHL3, GST-tagged | +Inquiry |
Uchl3-6820M | Recombinant Mouse Uchl3 Protein, Myc/DDK-tagged | +Inquiry |
UCHL3-5086R | Recombinant Rhesus monkey UCHL3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL3-534HCL | Recombinant Human UCHL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCHL3 Products
Required fields are marked with *
My Review for All UCHL3 Products
Required fields are marked with *
0
Inquiry Basket