Recombinant Full Length Human UCHL5 Protein, C-Flag-tagged
Cat.No. : | UCHL5-2070HFL |
Product Overview : | Recombinant Full Length Human UCHL5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables endopeptidase inhibitor activity; proteasome binding activity; and thiol-dependent deubiquitinase. Involved in negative regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of smoothened signaling pathway; and protein deubiquitination. Located in cytosol; nucleolus; and nucleoplasm. Colocalizes with Ino80 complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.4 kDa |
AA Sequence : | MTGNAGEWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQ DSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVH NSFARQQMFEFDTKTSAKEEDAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK YSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEEPMDTDQGNSMLSAIQSEVAKNQMLIEEEVQKLKR YKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKAKEKQNAKKAQETK myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | UCHL5 ubiquitin C-terminal hydrolase L5 [ Homo sapiens (human) ] |
Official Symbol | UCHL5 |
Synonyms | Enables endopeptidase inhibitor activity; proteasome binding activity; and thiol-dependent deubiquitinase. Involved in negative regulation of proteasomal ubiquitin-dependent protein catabolic process; positive regulation of smoothened signaling pathway; and protein deubiquitination. Located in cytosol; nucleolus; and nucleoplasm. Colocalizes with Ino80 complex. |
Gene ID | 51377 |
mRNA Refseq | NM_015984.5 |
Protein Refseq | NP_057068.1 |
MIM | 610667 |
UniProt ID | Q9Y5K5 |
◆ Recombinant Proteins | ||
UCHL5-12312Z | Recombinant Zebrafish UCHL5 | +Inquiry |
UCHL5-2840H | Recombinant Human UCHL5 protein, His-tagged | +Inquiry |
UCHL5-690H | Recombinant Human ubiquitin carboxyl-terminal hydrolase L5, His-tagged | +Inquiry |
UCHL5-1668C | Recombinant Chicken UCHL5 | +Inquiry |
UCHL5-2070HFL | Recombinant Full Length Human UCHL5 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCHL5-533HCL | Recombinant Human UCHL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCHL5 Products
Required fields are marked with *
My Review for All UCHL5 Products
Required fields are marked with *