Recombinant Full Length Human UCK2, C His-tagged
| Cat.No. : | UCK2-30101TH |
| Product Overview : | Recombinant full length Human UCK2 (amino acids 1-261) with C terminal His tag; 269 amino acids with tag, MWt 30.3 kDa. |
| Availability | August 25, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-261 a.a. |
| Description : | This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. |
| Conjugation : | HIS |
| Molecular Weight : | 30.300kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 1mM EDTA, 0.1mM PMSF, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPHLEHHHHHH |
| Gene Name | UCK2 uridine-cytidine kinase 2 [ Homo sapiens ] |
| Official Symbol | UCK2 |
| Synonyms | UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase; |
| Gene ID | 7371 |
| mRNA Refseq | NM_012474 |
| Protein Refseq | NP_036606 |
| MIM | 609329 |
| Uniprot ID | Q9BZX2 |
| Chromosome Location | 1p32 |
| Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
| Function | ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor; |
| ◆ Recombinant Proteins | ||
| UCK2-4901R | Recombinant Rhesus Macaque UCK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Uck2-6823M | Recombinant Mouse Uck2 Protein, Myc/DDK-tagged | +Inquiry |
| UCK2-776H | Recombinant Human UCK2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| UCK2-1663HFL | Recombinant Full Length Human UCK2 Protein, C-Flag-tagged | +Inquiry |
| UCK2-3575H | Recombinant Full Length Human UCK2, N His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UCK2-531HCL | Recombinant Human UCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCK2 Products
Required fields are marked with *
My Review for All UCK2 Products
Required fields are marked with *


