Recombinant Full Length Human UCK2, C His-tagged
Cat.No. : | UCK2-30101TH |
Product Overview : | Recombinant full length Human UCK2 (amino acids 1-261) with C terminal His tag; 269 amino acids with tag, MWt 30.3 kDa. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-261 a.a. |
Description : | This gene encodes a pyrimidine ribonucleoside kinase. The encoded protein (EC 2.7.1.48) catalyzes phosphorylation of uridine and cytidine to uridine monophosphate (UMP) and cytidine monophosphate (CMP), respectively. |
Conjugation : | HIS |
Molecular Weight : | 30.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 2mM DTT, 100mM Sodium chloride, 1mM EDTA, 0.1mM PMSF, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPHLEHHHHHH |
Gene Name | UCK2 uridine-cytidine kinase 2 [ Homo sapiens ] |
Official Symbol | UCK2 |
Synonyms | UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase; |
Gene ID | 7371 |
mRNA Refseq | NM_012474 |
Protein Refseq | NP_036606 |
MIM | 609329 |
Uniprot ID | Q9BZX2 |
Chromosome Location | 1p32 |
Pathway | Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; |
Function | ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor; |
◆ Recombinant Proteins | ||
Uck2-6823M | Recombinant Mouse Uck2 Protein, Myc/DDK-tagged | +Inquiry |
UCK2-4901R | Recombinant Rhesus Macaque UCK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
UCK2-30101TH | Recombinant Full Length Human UCK2, C His-tagged | +Inquiry |
UCK2-930H | Recombinant Full Length Human Uridine-cytidine Kinase 2, C His-tagged | +Inquiry |
UCK2-5088R | Recombinant Rhesus monkey UCK2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCK2-531HCL | Recombinant Human UCK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All UCK2 Products
Required fields are marked with *
My Review for All UCK2 Products
Required fields are marked with *
0
Inquiry Basket