Recombinant Full Length Human UCK2 protein, N T7-tagged

• Cat.No.: UCK2-145H
• Product Overview: Recombinant human UCK2 (261 aa) fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 261 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGEFGSTSMAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQV VILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADV VLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADV IIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro UCK2 mediated phosphorylation of uridine-cytidine regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping UCK2 protein-protein interaction.4. May be used as antigen for specific antibody development.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: UCK2 uridine-cytidine kinase 2 [ Homo sapiens ]
• Official Symbol: UCK2
• Synonyms: UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase; uridine kinase; uridine monophosphokinase 2; cytidine monophosphokinase 2; uridine monophosphate kinase; testis-specific protein TSA903; UK; UMPK; TSA903; DKFZp686M04245
• Gene ID: 7371
• mRNA Refseq: NM_012474
• Protein Refseq: NP_036606
• MIM: 609329
• UniProt ID: Q9BZX2
• Chromosome Location: 1p32
• Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem
• Function: ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor; transferase activity; uridine kinase activity