Recombinant Full Length Human UCK2 protein, N T7-tagged

Cat.No. : UCK2-145H
Product Overview : Recombinant human UCK2 (261 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 261 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFGSTSMAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQV VILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADV VLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADV IIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro UCK2 mediated phosphorylation of uridine-cytidine regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping UCK2 protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name UCK2 uridine-cytidine kinase 2 [ Homo sapiens ]
Official Symbol UCK2
Synonyms UCK2; uridine-cytidine kinase 2; UMPK, uridine monophosphate kinase; uridine kinase; uridine monophosphokinase 2; cytidine monophosphokinase 2; uridine monophosphate kinase; testis-specific protein TSA903; UK; UMPK; TSA903; DKFZp686M04245;
Gene ID 7371
mRNA Refseq NM_012474
Protein Refseq NP_036606
MIM 609329
UniProt ID Q9BZX2
Chromosome Location 1p32
Pathway Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of nucleotides, organism-specific biosystem; Pyrimidine metabolism, organism-specific biosystem;
Function ATP binding; kinase activity; nucleoside kinase activity; nucleotide binding; phosphotransferase activity, alcohol group as acceptor; transferase activity; uridine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCK2 Products

Required fields are marked with *

My Review for All UCK2 Products

Required fields are marked with *

0
cart-icon
0
compare icon