Recombinant Full Length Human UCMA Protein, GST-tagged

• Cat.No.: UCMA-1700HF
• Product Overview: Human C10orf49 full-length ORF (AAH18068.2, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 138 amino acids
• Description: This gene encodes a chondrocyte-specific, highly charged protein that is abundantly expressed in the upper immature zone of fetal and juvenile epiphyseal cartilage. The encoded protein undergoes proteolytic processing to generate a mature protein that is secreted into the extracellular matrix. The glutamic acid residues in the encoded protein undergo gamma carboxylation in a vitamin K-dependent manner. Undercarboxylation of the encoded protein is associated with osteoarthritis in humans. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 41.58 kDa
• AA Sequence: MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
• Official Symbol: UCMA
• Synonyms: UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49
• Gene ID: 221044
• mRNA Refseq: NM_145314
• Protein Refseq: NP_660357
• UniProt ID: Q8WVF2