Recombinant Human UCMA protein, His-tagged
| Cat.No. : | UCMA-2511H | 
| Product Overview : | Recombinant Human UCMA protein(27-139 aa), fused to His tag, was expressed in E. coli. | 
| Availability | November 04, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 27-139 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | VSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT | 
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.  | 
                                
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.  | 
                                
| Gene Name | UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ] | 
| Official Symbol | UCMA | 
| Synonyms | UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49; | 
| Gene ID | 221044 | 
| mRNA Refseq | NM_145314 | 
| Protein Refseq | NP_660357 | 
| UniProt ID | Q8WVF2 | 
| ◆ Recombinant Proteins | ||
| UCMA-22H | Recombinant Human UCMA protein | +Inquiry | 
| UCMA-301149H | Recombinant Human UCMA protein, GST-tagged | +Inquiry | 
| UCMA-434H | Recombinant Human UCMA Protein, GST-tagged | +Inquiry | 
| UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry | 
| Ucma-531R | Recombinant Rat Ucma Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| UCMA-529HCL | Recombinant Human UCMA 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All UCMA Products
Required fields are marked with *
My Review for All UCMA Products
Required fields are marked with *
  
        
    
      
            