Recombinant Human UCMA protein

Cat.No. : UCMA-22H
Product Overview : Recombinant Human UCMA(Ser65-Thr138) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 65-138 a.a.
Description : C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.
Form : Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence : GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDG LHPSYLYNRHHT
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Storage : Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Gene Name UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ]
Official Symbol UCMA
Synonyms UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49;
Gene ID 221044
mRNA Refseq NM_145314
Protein Refseq NP_660357
UniProt ID Q8WVF2
Chromosome Location 10p13

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UCMA Products

Required fields are marked with *

My Review for All UCMA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon