Recombinant Human UCMA protein
Cat.No. : | UCMA-22H |
Product Overview : | Recombinant Human UCMA(Ser65-Thr138) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 65-138 a.a. |
Description : | C10orf49 is a secreted protein which encoded by the UCMA gene. It is a member of the UCMA family. C10orf49 is predominantly expressed in resting chondrocytes. It may be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface. |
Form : | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
AA Sequence : | GHMSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDG LHPSYLYNRHHT |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | UCMA upper zone of growth plate and cartilage matrix associated [ Homo sapiens ] |
Official Symbol | UCMA |
Synonyms | UCMA; upper zone of growth plate and cartilage matrix associated; C10orf49, chromosome 10 open reading frame 49; unique cartilage matrix-associated protein; Gla-rich protein; GRP; C10orf49; |
Gene ID | 221044 |
mRNA Refseq | NM_145314 |
Protein Refseq | NP_660357 |
UniProt ID | Q8WVF2 |
Chromosome Location | 10p13 |
◆ Recombinant Proteins | ||
UCMA-1700HF | Recombinant Full Length Human UCMA Protein, GST-tagged | +Inquiry |
UCMA-2511H | Recombinant Human UCMA protein, His-tagged | +Inquiry |
UCMA-22H | Recombinant Human UCMA protein | +Inquiry |
UCMA-301149H | Recombinant Human UCMA protein, GST-tagged | +Inquiry |
UCMA-434H | Recombinant Human UCMA Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
UCMA-529HCL | Recombinant Human UCMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UCMA Products
Required fields are marked with *
My Review for All UCMA Products
Required fields are marked with *
0
Inquiry Basket