Recombinant Full Length Human Uncharacterized Protein C19Orf75(C19Orf75) Protein, His-Tagged
Cat.No. : | RFL1045HF |
Product Overview : | Recombinant Full Length Human Uncharacterized protein C19orf75(C19orf75) Protein (Q8N7X8) (1-197aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-197) |
Form : | Lyophilized powder |
AA Sequence : | MLPLLQLVPAKLLNSSCSLEKTLQCSCSFHGIPTPSVQWWMGGVPVGVDGMDGSLQVTST MLGPWANSTISLTEEPEMGMRLLCEGKNQNGTHALSILLMSRKSSLAAQAFVKGLIQGAI YAGIVIALLFLCLLPLIVKHIRKKQAKKAAAIRAKKSSKVRASQELEMSLKPEEPGKPVV ATFSESRILEKQDKRAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SIGLECL1 |
Synonyms | SIGLECL1; C19orf75; SIGLEC family-like protein 1 |
UniProt ID | Q8N7X8 |
◆ Recombinant Proteins | ||
SIGLECL1-303H | Recombinant Human SIGLECL1 Protein, MYC/DDK-tagged | +Inquiry |
RFL1045HF | Recombinant Full Length Human Uncharacterized Protein C19Orf75(C19Orf75) Protein, His-Tagged | +Inquiry |
SIGLECL1-4202R | Recombinant Rhesus monkey SIGLECL1 Protein, His-tagged | +Inquiry |
SIGLECL1-4018R | Recombinant Rhesus Macaque SIGLECL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIGLECL1-8194HCL | Recombinant Human C19orf75 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIGLECL1 Products
Required fields are marked with *
My Review for All SIGLECL1 Products
Required fields are marked with *