Recombinant Full Length Human USP3 Protein, C-Flag-tagged
Cat.No. : | USP3-550HFL |
Product Overview : | Recombinant Full Length Human USP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables histone binding activity and thiol-dependent deubiquitinase. Involved in several processes, including DNA repair; histone deubiquitination; and regulation of protein stability. Located in several cellular components, including Flemming body; cytoplasmic ribonucleoprotein granule; and nucleoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 58.7 kDa |
AA Sequence : | MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKHYEDAQVPLTN HKKSEKQDKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQNLENSAFTADRHKKRKLLENS TLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRS QGDNNVSLVEEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGF NGVSRSAILQENSTLSASNKCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRS KRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV TLTDEETVVKAKAYILFYVEHQAKAGSDKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Full Length : | Full L. |
Gene Name | USP3 ubiquitin specific peptidase 3 [ Homo sapiens (human) ] |
Official Symbol | USP3 |
Synonyms | UBP; SIH003 |
Gene ID | 9960 |
mRNA Refseq | NM_006537.4 |
Protein Refseq | NP_006528.2 |
MIM | 604728 |
UniProt ID | Q9Y6I4 |
◆ Recombinant Proteins | ||
USP3-7885Z | Recombinant Zebrafish USP3 | +Inquiry |
USP3-4938R | Recombinant Rhesus Macaque USP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
USP3-5125R | Recombinant Rhesus monkey USP3 Protein, His-tagged | +Inquiry |
USP3-159H | Recombinant Human USP3 protein, T7/His-tagged | +Inquiry |
USP3-550HFL | Recombinant Full Length Human USP3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP3-462HCL | Recombinant Human USP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All USP3 Products
Required fields are marked with *
My Review for All USP3 Products
Required fields are marked with *
0
Inquiry Basket