Recombinant Full Length Human UXS1 Protein, GST tagged

Cat.No. : UXS1-3639H
Product Overview : Recombinant human UXS1 full-length ORF ( NP_079352.2, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : Full Length
Description : This gene encodes an enzyme found in the perinuclear Golgi which catalyzes the synthesis of UDP-xylose used in glycosaminoglycan (GAG) synthesis on proteoglycans. The GAG chains are covalently attached to proteoglycans which participate in signaling pathways during development. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 74 kDa
AA Sequence : MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens (human) ]
Official Symbol UXS1
Synonyms UXS1; UDP-glucuronate decarboxylase 1; UGD; hUXS; hUXS1; SDR6E1; UDP-glucuronic acid decarboxylase 1; UXS-1; short chain dehydrogenase/reductase family 6E, member 12; EC 4.1.1.35
Gene ID 80146
mRNA Refseq NM_025076
Protein Refseq NP_079352
MIM 609749
UniProt ID Q8NBX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UXS1 Products

Required fields are marked with *

My Review for All UXS1 Products

Required fields are marked with *

0
cart-icon