Recombinant Full Length Human UXS1 Protein, GST tagged
| Cat.No. : | UXS1-3639H |
| Product Overview : | Recombinant human UXS1 full-length ORF ( NP_079352.2, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | Full Length |
| Description : | This gene encodes an enzyme found in the perinuclear Golgi which catalyzes the synthesis of UDP-xylose used in glycosaminoglycan (GAG) synthesis on proteoglycans. The GAG chains are covalently attached to proteoglycans which participate in signaling pathways during development. Multiple transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 74 kDa |
| AA Sequence : | MVSKALLRLVSAVNRRRMKLLLGIALLAYVASVWGNFVNMRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDVVEPLYIEVDQIYHLASPASPPNYMYNPIKTLKTNTIGTLNMLGLAKRVGARLLLASTSEVYGDPEVHPQSEDYWGHVNPIGPRACYDEGKRVAETMCYAYMKQEGVEVRVARIFNTFGPRMHMNDGRVVSNFILQALQGEPLTVYGSGSQTRAFQYVSDLVNGLVALMNSNVSSPVNLGNPEEHTILEFAQLIKNLVGSGSEIQFLSEAQDDPQKRKPDIKKAKLMLGWEPVVPLEEGLNKAIHYFRKELEYQANNQYIPKPKPARIKKGRTRHS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | UXS1 UDP-glucuronate decarboxylase 1 [ Homo sapiens (human) ] |
| Official Symbol | UXS1 |
| Synonyms | UXS1; UDP-glucuronate decarboxylase 1; UGD; hUXS; hUXS1; SDR6E1; UDP-glucuronic acid decarboxylase 1; UXS-1; short chain dehydrogenase/reductase family 6E, member 12; EC 4.1.1.35 |
| Gene ID | 80146 |
| mRNA Refseq | NM_025076 |
| Protein Refseq | NP_079352 |
| MIM | 609749 |
| UniProt ID | Q8NBX3 |
| ◆ Recombinant Proteins | ||
| UXS1-6487R | Recombinant Rat UXS1 Protein | +Inquiry |
| UXS1-9516Z | Recombinant Zebrafish UXS1 | +Inquiry |
| UXS1-17965M | Recombinant Mouse UXS1 Protein | +Inquiry |
| Uxs1-6888M | Recombinant Mouse Uxs1 Protein, Myc/DDK-tagged | +Inquiry |
| UXS1-3639H | Recombinant Full Length Human UXS1 Protein, GST tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UXS1-443HCL | Recombinant Human UXS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UXS1 Products
Required fields are marked with *
My Review for All UXS1 Products
Required fields are marked with *
