Recombinant Full Length Human VASH1 Protein, His tagged

Cat.No. : VASH1-3096HFL
Product Overview : Recombinant Full Length Human VASH1 Protein (2-365 aa) with C-His tag was expressed in Baculovirus-Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 2-365 aa
Description : Enables actin binding activity and metallocarboxypeptidase activity. Involved in negative regulation of angiogenesis; negative regulation of blood vessel endothelial cell migration; and proteolysis. Acts upstream of or within several processes, including negative regulation of endothelial cell proliferation; negative regulation of lymphangiogenesis; and regulation of cellular senescence. Located in apical part of cell; endoplasmic reticulum; and extracellular space. Implicated in liver cirrhosis and portal hypertension. Biomarker of liver cirrhosis.
Source : Insect cells
Species : Human
Tag : C-His
Molecular Weight : 42 kDa
AA Sequence : MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRVHHHHHHHH
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 4% Trehalose, 0.5% SKL
Concentration : 1 mg/mL by Bradford
Gene Name VASH1 vasohibin 1 [ Homo sapiens (human) ]
Official Symbol VASH1
Synonyms VASH1; vasohibin 1; KIAA1036; vasohibin-1
Gene ID 22846
mRNA Refseq NM_014909
Protein Refseq NP_055724
MIM 609011
UniProt ID Q7L8A9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VASH1 Products

Required fields are marked with *

My Review for All VASH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon