Recombinant Full Length Human VASH1 Protein, His tagged
Cat.No. : | VASH1-3096HFL |
Product Overview : | Recombinant Full Length Human VASH1 Protein (2-365 aa) with C-His tag was expressed in Baculovirus-Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect cells |
Tag : | His |
Protein Length : | 2-365 aa |
Description : | Enables actin binding activity and metallocarboxypeptidase activity. Involved in negative regulation of angiogenesis; negative regulation of blood vessel endothelial cell migration; and proteolysis. Acts upstream of or within several processes, including negative regulation of endothelial cell proliferation; negative regulation of lymphangiogenesis; and regulation of cellular senescence. Located in apical part of cell; endoplasmic reticulum; and extracellular space. Implicated in liver cirrhosis and portal hypertension. Biomarker of liver cirrhosis. |
Source : | Insect cells |
Species : | Human |
Tag : | C-His |
Molecular Weight : | 42 kDa |
AA Sequence : | MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRVHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol, 4% Trehalose, 0.5% SKL |
Concentration : | 1 mg/mL by Bradford |
Gene Name | VASH1 vasohibin 1 [ Homo sapiens (human) ] |
Official Symbol | VASH1 |
Synonyms | VASH1; vasohibin 1; KIAA1036; vasohibin-1 |
Gene ID | 22846 |
mRNA Refseq | NM_014909 |
Protein Refseq | NP_055724 |
MIM | 609011 |
UniProt ID | Q7L8A9 |
◆ Recombinant Proteins | ||
Vash1-6898M | Recombinant Mouse Vash1 Protein, Myc/DDK-tagged | +Inquiry |
VASH1-3096HFL | Recombinant Full Length Human VASH1 Protein, His tagged | +Inquiry |
VASH1-3649H | Recombinant Human VASH1, GST-tagged | +Inquiry |
VASH1-17983M | Recombinant Mouse VASH1 Protein | +Inquiry |
VASH1-13H | Recombinant Human VASH1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VASH1-428HCL | Recombinant Human VASH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VASH1 Products
Required fields are marked with *
My Review for All VASH1 Products
Required fields are marked with *