Recombinant Full Length Human VPS25 Protein, GST-tagged
Cat.No. : | VPS25-6255HF |
Product Overview : | Human MGC10540 full-length ORF ( AAH06282, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 176 amino acids |
Description : | VPS25, VPS36 (MIM 610903), and SNF8 (MIM 610904) form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. VPS25, VPS36, and SNF8 are also associated in a multiprotein complex with RNA polymerase II elongation factor (ELL; MIM 600284) (Slagsvold et al., 2005 [PubMed 15755741]; Kamura et al., 2001 [PubMed 11278625]).[supplied by OMIM |
Molecular Mass : | 45.1 kDa |
AA Sequence : | MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | VPS25 vacuolar protein sorting 25 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VPS25 |
Synonyms | VPS25; vacuolar protein sorting 25 homolog (S. cerevisiae); vacuolar protein sorting 25 (yeast); vacuolar protein-sorting-associated protein 25; DERP9; EAP20; MGC10540; ESCRT-II complex subunit VPS25; ELL-associated protein of 20 kDa; dermal papilla-derived protein 9; FAP20; |
Gene ID | 84313 |
mRNA Refseq | NM_032353 |
Protein Refseq | NP_115729 |
MIM | 610907 |
UniProt ID | Q9BRG1 |
◆ Recombinant Proteins | ||
VPS25-10060M | Recombinant Mouse VPS25 Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS25-6196R | Recombinant Rat VPS25 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vps25-6931M | Recombinant Mouse Vps25 Protein, Myc/DDK-tagged | +Inquiry |
VPS25-6255HF | Recombinant Full Length Human VPS25 Protein, GST-tagged | +Inquiry |
VPS25-18365M | Recombinant Mouse VPS25 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
VPS25-395HCL | Recombinant Human VPS25 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VPS25 Products
Required fields are marked with *
My Review for All VPS25 Products
Required fields are marked with *