Recombinant Full Length Human VSIG2 Protein, C-Flag-tagged
Cat.No. : | VSIG2-1969HFL |
Product Overview : | Recombinant Full Length Human VSIG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to be located in membrane. Predicted to be integral component of plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MAELPGPFLCGALLGFLCLSGLAVEVKVPTEPLSTPLGKTAELTCTYSTSVGDSFALEWSFVQPGKPISE SHPILYFTNGHLYPTGSKSKRVSLLQNPPTVGVATLKLTDVHPSDTGTYLCQVNNPPDFYTNGLGLINLT VLVPPSNPLCSQSGQTSVGGSTALRCSSSEGAPKPVYNWVRLGTFPTPSPGSMVQDEVSGQLILTNLSLT SSGTYRCVATNQMGSASCELTLSVTEPSQGRVAGALIGVLLGVLLLSVAAFCLVRFQKERGKKPKETYGG SDLREDAIAPGISEHTCMRADSSKGFLERPSSASTVTTTKSKLPMVV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | VSIG2 V-set and immunoglobulin domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | VSIG2 |
Synonyms | CTH; CTXL; 2210413P10Rik |
Gene ID | 23584 |
mRNA Refseq | NM_014312.5 |
Protein Refseq | NP_055127.2 |
MIM | 606011 |
UniProt ID | Q96IQ7 |
◆ Recombinant Proteins | ||
VSIG2-10083M | Recombinant Mouse VSIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vsig2-6947M | Recombinant Mouse Vsig2 Protein, Myc/DDK-tagged | +Inquiry |
VSIG2-2344H | Recombinant Human VSIG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSIG2-18394M | Recombinant Mouse VSIG2 Protein | +Inquiry |
VSIG2-1969HFL | Recombinant Full Length Human VSIG2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSIG2-1915HCL | Recombinant Human VSIG2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSIG2 Products
Required fields are marked with *
My Review for All VSIG2 Products
Required fields are marked with *
0
Inquiry Basket