Recombinant Full Length Human VSIG8 Protein, C-Flag-tagged
Cat.No. : | VSIG8-1833HFL |
Product Overview : | Recombinant Full Length Human VSIG8 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables RNA binding activity. Predicted to be integral component of membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MRVGGAFHLLLVCLSPALLSAVRINGDGQEVLYLAEGDNVRLGCPYVLDPEDYGPNGLDIEWMQVNSDPA HHRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDTATYECRVKKTTMATRKVIV TVQARPAVPMCWTEGHMTYGNDVVLKCYASGGSQPLSYKWAKISGHHYPYRAGSYTSQHSYHSELSYQES FHSSINQGLNNGDLVLKDISRADDGLYQCTVANNVGYSVCVVEVKVSDSRRIGVIIGIVLGSLLALGCLA VGIWGLVCCCCGGSGAGGARGAFGYGNGGGVGGGACGDLASEIREDAVAPGCKASGRGSRVTHLLGYPTQ NVSRSLRRKYAPPPCGGPEDVALAPCTAAAACEAGPSPVYVKVKSAEPADCAEGPVQCKNGLLV myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | VSIG8 V-set and immunoglobulin domain containing 8 [ Homo sapiens (human) ] |
Official Symbol | VSIG8 |
Synonyms | OTTHUMP00000033460; V-set and immunoglobulin domain containing 8 |
Gene ID | 391123 |
mRNA Refseq | NM_001013661.1 |
Protein Refseq | NP_001013683.1 |
UniProt ID | P0DPA2 |
◆ Recombinant Proteins | ||
VSIG8-368H | Recombinant Human VSIG8 protein, His-tagged | +Inquiry |
Vsig8-123M | Recombinant Mouse Vsig8 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSIG8-10084M | Recombinant Mouse VSIG8 Protein, His (Fc)-Avi-tagged | +Inquiry |
VSIG8-409H | Recombinant Human VSIG8 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
VSIG8-2345H | Recombinant Human VSIG8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VSIG8-001HCL | Recombinant Human VSIG8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSIG8 Products
Required fields are marked with *
My Review for All VSIG8 Products
Required fields are marked with *