Recombinant Full Length Human VSIR Protein, C-Flag-tagged
| Cat.No. : | VSIR-948HFL |
| Product Overview : | Recombinant Full Length Human VSIR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Enables endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Involved in several processes, including negative regulation of cytokine production; positive regulation of macromolecule metabolic process; and regulation of T cell activation. Located in plasma membrane. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 33.7 kDa |
| AA Sequence : | MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQESENITAAALATGACIVGILCLPL ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | VSIR V-set immunoregulatory receptor [ Homo sapiens (human) ] |
| Official Symbol | VSIR |
| Synonyms | B7H5; GI24; B7-H5; Dies1; PD-1H; SISP1; VISTA; PP2135; C10orf54; DD1alpha |
| Gene ID | 64115 |
| mRNA Refseq | NM_022153.2 |
| Protein Refseq | NP_071436.1 |
| MIM | 615608 |
| UniProt ID | Q9H7M9 |
| ◆ Recombinant Proteins | ||
| Vsir-1011MF | Recombinant Mouse Vsir Protein, Fc-tagged, FITC conjugated | +Inquiry |
| VSIR-5465H | Recombinant Human VSIR protein, His-tagged | +Inquiry |
| VSIR-607M | Recombinant Mouse VSIR Protein | +Inquiry |
| VSIR-363R | Recombinant Rhesus macaque VSIR protein, His-tagged | +Inquiry |
| VSIR-303CAF488 | Recombinant Monkey VISTA Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSIR Products
Required fields are marked with *
My Review for All VSIR Products
Required fields are marked with *
