Recombinant Full Length Human VSIR Protein, C-Flag-tagged
Cat.No. : | VSIR-948HFL |
Product Overview : | Recombinant Full Length Human VSIR Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables endopeptidase activator activity; enzyme binding activity; and identical protein binding activity. Involved in several processes, including negative regulation of cytokine production; positive regulation of macromolecule metabolic process; and regulation of T cell activation. Located in plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.7 kDa |
AA Sequence : | MGVPTALEAGSWRWGSLLFALFLAASLGPVAAFKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYK TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLD SGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQESENITAAALATGACIVGILCLPL ILLLVYKQRQAASNRRAQELVRMDSNIQGIENPGFEASPPAQGIPEAKVRHPLSYVAQRQPSESGRHLLS EPSTPLSPPGPGDVFFPSLDPVPDSPNFEVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | VSIR V-set immunoregulatory receptor [ Homo sapiens (human) ] |
Official Symbol | VSIR |
Synonyms | B7H5; GI24; B7-H5; Dies1; PD-1H; SISP1; VISTA; PP2135; C10orf54; DD1alpha |
Gene ID | 64115 |
mRNA Refseq | NM_022153.2 |
Protein Refseq | NP_071436.1 |
MIM | 615608 |
UniProt ID | Q9H7M9 |
◆ Recombinant Proteins | ||
VSIR-606H | Recombinant Human VSIR Protein, Fc-tagged | +Inquiry |
VSIR-151H | Recombinant Human VSIR Protein, DYKDDDDK-tagged | +Inquiry |
VSIR-1520R | Recombinant Rhesus Monkey VSIR Protein, hIgG4-tagged | +Inquiry |
B7H5-1155RAF555 | Recombinant Rat B7H5 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
VSIR-19H | Recombinant Human VSIR protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSIR Products
Required fields are marked with *
My Review for All VSIR Products
Required fields are marked with *