Recombinant Full Length Human VSX2 Protein, GST-tagged
| Cat.No. : | VSX2-1838HF |
| Product Overview : | Human CHX10 full-length ORF ( NP_878314.1, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 361 amino acids |
| Description : | This gene encodes a homeobox protein originally described as a retina-specific transcription factor. Mutations in this gene are associated with microphthalmia, cataracts and iris abnormalities. [provided by RefSeq, Oct 2009] |
| Molecular Mass : | 65.8 kDa |
| AA Sequence : | MTGKAGEALSKPKSETVAKSTSGGAPARCTGFGIQEILGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGMGLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPLDTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTIFTSYQLEELEKAFNEAHYPDVYAREMLAMKTELPEDRIQVWFQNRRAKWRKREKCWGRSSVMAEYGLYGAMVRHSIPLPESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKMEQDERGPDAQAAISQEELRENSIAVLRAKAQEHSTKVLGTVSGPDSLARSTEKPEEEEAMDEDRPAERLSPPQLEDMA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | VSX2 visual system homeobox 2 [ Homo sapiens ] |
| Official Symbol | VSX2 |
| Synonyms | VSX2; visual system homeobox 2; C elegans ceh 10 homeo domain containing homolog , ceh 10 homeo domain containing homolog (C. elegans) , ceh 10 homeodomain containing homolog (C. elegans) , CHX10, HOX10; RET1; homeobox protein CHX10; ceh-10 homeodomain-containing homolog; ceh-10 homeo domain containing homolog; CHX10; HOX10; MCOP2; MCOPCB3 |
| Gene ID | 338917 |
| mRNA Refseq | NM_182894 |
| Protein Refseq | NP_878314 |
| MIM | 142993 |
| UniProt ID | P58304 |
| ◆ Recombinant Proteins | ||
| Vsx2-890M | Recombinant Mouse Vsx2 Protein, MYC/DDK-tagged | +Inquiry |
| VSX2-1353H | Recombinant Human VSX2 Protein, GST-tagged | +Inquiry |
| VSX2-9029Z | Recombinant Zebrafish VSX2 | +Inquiry |
| VSX2-1529H | Recombinant Human VSX2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| VSX2-10089M | Recombinant Mouse VSX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| VSX2-356HCL | Recombinant Human VSX2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VSX2 Products
Required fields are marked with *
My Review for All VSX2 Products
Required fields are marked with *
