Recombinant Full Length Human VTA1 Protein, C-Flag-tagged

• Cat.No.: VTA1-870HFL
• Product Overview: Recombinant Full Length Human VTA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 33.7 kDa
• AA Sequence: MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG
  SALQYEDVSTAVQNLQKALKLLTTGRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Endocytosis
• Full Length: Full L.

Gene Information

• Gene Name: VTA1 vesicle trafficking 1 [ Homo sapiens (human) ]
• Official Symbol: VTA1
• Synonyms: DRG1; LIP5; SBP1; DRG-1; My012; 6orf55; C6orf55; HSPC228
• Gene ID: 51534
• mRNA Refseq: NM_016485.5
• Protein Refseq: NP_057569.2
• MIM: 610902
• UniProt ID: Q9NP79