Recombinant Full Length Human VTA1 Protein, C-Flag-tagged

Cat.No. : VTA1-870HFL
Product Overview : Recombinant Full Length Human VTA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 33.7 kDa
AA Sequence : MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG
SALQYEDVSTAVQNLQKALKLLTTGRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Endocytosis
Full Length : Full L.
Gene Name VTA1 vesicle trafficking 1 [ Homo sapiens (human) ]
Official Symbol VTA1
Synonyms DRG1; LIP5; SBP1; DRG-1; My012; 6orf55; C6orf55; HSPC228
Gene ID 51534
mRNA Refseq NM_016485.5
Protein Refseq NP_057569.2
MIM 610902
UniProt ID Q9NP79

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VTA1 Products

Required fields are marked with *

My Review for All VTA1 Products

Required fields are marked with *

0
cart-icon