Recombinant Full Length Human VTA1 Protein, C-Flag-tagged
Cat.No. : | VTA1-870HFL |
Product Overview : | Recombinant Full Length Human VTA1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.7 kDa |
AA Sequence : | MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG SALQYEDVSTAVQNLQKALKLLTTGRETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Endocytosis |
Full Length : | Full L. |
Gene Name | VTA1 vesicle trafficking 1 [ Homo sapiens (human) ] |
Official Symbol | VTA1 |
Synonyms | DRG1; LIP5; SBP1; DRG-1; My012; 6orf55; C6orf55; HSPC228 |
Gene ID | 51534 |
mRNA Refseq | NM_016485.5 |
Protein Refseq | NP_057569.2 |
MIM | 610902 |
UniProt ID | Q9NP79 |
◆ Recombinant Proteins | ||
VTA1-5554H | Recombinant Human Vps20-Associated 1 Homolog (S. cerevisiae), His-tagged | +Inquiry |
VTA1-18403M | Recombinant Mouse VTA1 Protein | +Inquiry |
VTA1-2349H | Recombinant Human VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VTA1-5924H | Recombinant Human VTA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VTA1-10090M | Recombinant Mouse VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTA1-375HCL | Recombinant Human VTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTA1 Products
Required fields are marked with *
My Review for All VTA1 Products
Required fields are marked with *