Recombinant Human VTA1
Cat.No. : | VTA1-31541TH |
Product Overview : | Recombinant full length Human VTA1 expressed in Saccharomyces cerevisiae, 307 amino acids , |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRL YAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNE AITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIK SFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCL KNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPS SSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHST GVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARA QKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE |
Sequence Similarities : | Belongs to the VTA1 family. |
Full Length : | Full L. |
Gene Name | VTA1 Vps20-associated 1 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | VTA1 |
Synonyms | VTA1; Vps20-associated 1 homolog (S. cerevisiae); C6orf55, chromosome 6 open reading frame 55; vacuolar protein sorting-associated protein VTA1 homolog; HSPC228; My012; |
Gene ID | 51534 |
mRNA Refseq | NM_016485 |
Protein Refseq | NP_057569 |
MIM | 610902 |
Uniprot ID | Q9NP79 |
Chromosome Location | 6q24.1 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; |
◆ Recombinant Proteins | ||
VTA1-5554H | Recombinant Human Vps20-Associated 1 Homolog (S. cerevisiae), His-tagged | +Inquiry |
VTA1-2349H | Recombinant Human VTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Vta1-6954M | Recombinant Mouse Vta1 Protein, Myc/DDK-tagged | +Inquiry |
VTA1-5180R | Recombinant Rhesus monkey VTA1 Protein, His-tagged | +Inquiry |
VTA1-870HFL | Recombinant Full Length Human VTA1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTA1-375HCL | Recombinant Human VTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTA1 Products
Required fields are marked with *
My Review for All VTA1 Products
Required fields are marked with *