Recombinant Full Length Human WDR83 Protein, C-Flag-tagged
Cat.No. : | WDR83-1629HFL |
Product Overview : | Recombinant Full Length Human WDR83 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the WD-40 protein family. The protein is proposed to function as a molecular scaffold for various multimeric protein complexes. The protein associates with several components of the extracellular signal-regulated kinase (ERK) pathway, and promotes ERK activity in response to serum or other signals. The protein also interacts with egl nine homolog 3 (EGLN3, also known as PHD3) and regulates expression of hypoxia-inducible factor 1, and has been purified as part of the spliceosome. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.2 kDa |
AA Sequence : | MAFPEPKPRPPELPQKRLKTLDCGQGAVRAVRFNVDGNYCLTCGSDKTLKLWNPLRGTLLRTYSGHGYEV LDAAGSFDNSSLCSGGGDKAVVLWDVASGQVVRKFRGHAGKVNTVQFNEEATVILSGSIDSSIRCWDCRS RRPEPVQTLDEARDGVSSVKVSDHEILAGSVDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSS LDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVV QSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | WDR83 WD repeat domain 83 [ Homo sapiens (human) ] |
Official Symbol | WDR83 |
Synonyms | MORG1 |
Gene ID | 84292 |
mRNA Refseq | NM_032332.4 |
Protein Refseq | NP_115708.1 |
MIM | 616850 |
UniProt ID | Q9BRX9 |
◆ Recombinant Proteins | ||
WDR83-563Z | Recombinant Zebrafish WDR83 | +Inquiry |
WDR83-2354H | Recombinant Human WDR83 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR83-5020R | Recombinant Rhesus Macaque WDR83 Protein, His (Fc)-Avi-tagged | +Inquiry |
WDR83-5207R | Recombinant Rhesus monkey WDR83 Protein, His-tagged | +Inquiry |
WDR83-6235R | Recombinant Rat WDR83 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WDR83-331HCL | Recombinant Human WDR83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WDR83 Products
Required fields are marked with *
My Review for All WDR83 Products
Required fields are marked with *
0
Inquiry Basket