Recombinant Full Length Human WFDC10A Protein, Flag tagged

• Cat.No.: WFDC10A-08HFL
• Product Overview: Recombinant protein of human WAP four-disulfide core domain 10A (WFDC10A) with Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293T
• Tag: Flag
• Protein Length: 1-79 aa
• Description: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster.
• Form: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Molecular Mass: 6.7 kDa
• AASequence: MAPQTLLPVLVLCVLLLQAQGGYRDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHRDCQANNICCSTYCGNVCMSILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80 centigrade. Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: WFDC10A WAP four-disulfide core domain 10A [ Homo sapiens (human) ]
• Official Symbol: WFDC10A
• Synonyms: WFDC10A; WAP four-disulfide core domain 10A; WAP10; C20orf146; dJ688G8.3; WAP four-disulfide core domain protein 10A; putative protease inhibitor WAP10A
• Gene ID: 140832
• mRNA Refseq: NM_080753
• Protein Refseq: NP_542791
• UniProt ID: Q9H1F0