Recombinant Full Length Human wild-type Tau 2N4R

Cat.No. : Tau dGAE-01H
Product Overview : Recombinant Human Tau dGAE Monomers (297-391 aa) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 297-391 aa
Description : This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer''s disease, Pick''s disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.
Tag : Non
Molecular Mass : 10.165 kDa
AA Sequence : IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Purity : > 95%
Applications : WB, SDS PAGE, In vitro Assay
Storage : Store at -80 centigrade.
Storage Buffer : 10mM PB pH 7.4, 10mM DTT
Concentration : 2 mg/mL or 5 mg/mL
Shipping : Dry Ice. Product will be shipped separately from other products purchased in the same order.
Gene Name MAPT microtubule associated protein tau [ Homo sapiens (human) ]
Official Symbol MAPT
Synonyms MAPT; microtubule associated protein tau; TAU; FTD1; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; tau-40; FTDP-17; PPP1R103; Tau-PHF6; microtubule-associated protein tau; G protein beta1/gamma2 subunit-interacting factor 1; PHF-tau; Tau-derived paired helical filament hexapeptide; neurofibrillary tangle protein; paired helical filament-tau; protein phosphatase 1, regulatory subunit 103
Gene ID 4137
mRNA Refseq NM_016835
Protein Refseq NP_058519
MIM 157140
UniProt ID P10636

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tau dGAE Products

Required fields are marked with *

My Review for All Tau dGAE Products

Required fields are marked with *

0
cart-icon