Recombinant Full Length Human WNT6 Protein, GST-tagged
Cat.No. : | WNT6-6263HF |
Product Overview : | Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 365 amino acids |
Description : | Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14. |
Form : | Liquid |
Molecular Mass : | 66.1 kDa |
AA Sequence : | MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ] |
Official Symbol | WNT6 |
Synonyms | WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6 |
Gene ID | 7475 |
mRNA Refseq | NM_006522 |
Protein Refseq | NP_006513 |
MIM | 604663 |
UniProt ID | Q9Y6F9 |
◆ Recombinant Proteins | ||
WNT6-1746C | Recombinant Chicken WNT6 | +Inquiry |
WNT6-12H | Recombinant Human WNT6 Protein, GST-tagged | +Inquiry |
WNT6-120H | Recombinant Human WNT6 Protein | +Inquiry |
WNT6-10200M | Recombinant Mouse WNT6 Protein, His (Fc)-Avi-tagged | +Inquiry |
WNT6-6263HF | Recombinant Full Length Human WNT6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT6-290HCL | Recombinant Human WNT6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT6 Products
Required fields are marked with *
My Review for All WNT6 Products
Required fields are marked with *
0
Inquiry Basket