Recombinant Full Length Human WNT6 Protein, GST-tagged

Cat.No. : WNT6-6263HF
Product Overview : Human WNT6 full-length ORF ( NP_006513.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 365 amino acids
Description : Molybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
Form : Liquid
Molecular Mass : 66.1 kDa
AA Sequence : MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGDEKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKELSLCL
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name WNT6 wingless-type MMTV integration site family, member 6 [ Homo sapiens ]
Official Symbol WNT6
Synonyms WNT6; wingless-type MMTV integration site family, member 6; protein Wnt-6
Gene ID 7475
mRNA Refseq NM_006522
Protein Refseq NP_006513
MIM 604663
UniProt ID Q9Y6F9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All WNT6 Products

Required fields are marked with *

My Review for All WNT6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon