Recombinant Full Length Human WWTR1 Protein, C-Flag-tagged
Cat.No. : | WWTR1-240HFL |
Product Overview : | Recombinant Full Length Human WWTR1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Transcriptional coactivator which acts as a downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. WWTR1 enhances PAX8 and NKX2-1/TTF1-dependent gene activation. Regulates the nuclear accumulation of SMADS and has a key role in coupling them to the transcriptional machinery such as the mediator complex. Regulates embryonic stem-cell self-renewal, promotes cell proliferation and epithelial-mesenchymal transition. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.9 kDa |
AA Sequence : | MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSS GGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQR YFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHP TQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVN PPTMTPDMRSITNNSSDPFLNGGPYHSREQSTDSGLGLGCYSVPTTPEDFLSNVDEMDTGENAGQTPMNI NPQQTRFPDFLDCLPGTNVDLGTLESEDLIPLFNDVESALNKSEPFLTWLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | WWTR1 WW domain containing transcription regulator 1 [ Homo sapiens (human) ] |
Official Symbol | WWTR1 |
Synonyms | TAZ |
Gene ID | 25937 |
mRNA Refseq | NM_015472.6 |
Protein Refseq | NP_056287.1 |
MIM | 607392 |
UniProt ID | Q9GZV5 |
◆ Recombinant Proteins | ||
WWTR1-10217M | Recombinant Mouse WWTR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
WWTR1-3589Z | Recombinant Zebrafish WWTR1 | +Inquiry |
WWTR1-18598M | Recombinant Mouse WWTR1 Protein | +Inquiry |
WWTR1-3611H | Recombinant Human WWTR1 protein, His-tagged | +Inquiry |
WWTR1-3635H | Recombinant Human WWTR1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WWTR1-272HCL | Recombinant Human WWTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WWTR1 Products
Required fields are marked with *
My Review for All WWTR1 Products
Required fields are marked with *
0
Inquiry Basket