Recombinant Human WWTR1 protein, GST-tagged

• Cat.No.: WWTR1-3635H
• Product Overview: Recombinant Human WWTR1 protein(160-294 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 160-294 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: NQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNN
• Purity: 80%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: WWTR1 WW domain containing transcription regulator 1 [ Homo sapiens ]
• Official Symbol: WWTR1
• Synonyms: WWTR1; WW domain containing transcription regulator 1; WW domain-containing transcription regulator protein 1; DKFZp586I1419; TAZ; transcriptional coactivator with PDZ-binding motif; transcriptional co-activator with PDZ-binding motif; FLJ27004; FLJ45718
• mRNA Refseq: NM_001168278
• Protein Refseq: NP_001161750
• MIM: 607392
• UniProt ID: Q9GZV5
• Gene ID: 25937