Recombinant Human WWTR1 protein, GST-tagged
| Cat.No. : | WWTR1-3635H |
| Product Overview : | Recombinant Human WWTR1 protein(160-294 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 160-294 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | NQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELMRQEAALCRQLPMEAETLAPVQAAVNPPTMTPDMRSITNN |
| Purity : | 80%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | WWTR1 WW domain containing transcription regulator 1 [ Homo sapiens ] |
| Official Symbol | WWTR1 |
| Synonyms | WWTR1; WW domain containing transcription regulator 1; WW domain-containing transcription regulator protein 1; DKFZp586I1419; TAZ; transcriptional coactivator with PDZ-binding motif; transcriptional co-activator with PDZ-binding motif; FLJ27004; FLJ45718; |
| mRNA Refseq | NM_001168278 |
| Protein Refseq | NP_001161750 |
| MIM | 607392 |
| UniProt ID | Q9GZV5 |
| Gene ID | 25937 |
| ◆ Recombinant Proteins | ||
| WWTR1-240HFL | Recombinant Full Length Human WWTR1 Protein, C-Flag-tagged | +Inquiry |
| WWTR1-5796H | Recombinant Human WWTR1 Protein (Met1-Leu400), N-His tagged | +Inquiry |
| WWTR1-3635H | Recombinant Human WWTR1 protein, GST-tagged | +Inquiry |
| WWTR1-2480H | Recombinant human WWTR1, His-tagged | +Inquiry |
| WWTR1-3611H | Recombinant Human WWTR1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WWTR1-272HCL | Recombinant Human WWTR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WWTR1 Products
Required fields are marked with *
My Review for All WWTR1 Products
Required fields are marked with *
