Recombinant Full Length Human YBX1 Protein, Flag tagged, Biotinylated

• Cat.No.: YBX1-3540HFLB
• Product Overview: This YBX1 protein is a recombinant full-length human protein expressed in HEK293 cells with Flag tag and biotinylated. YBX1 is a DNA/RNA-binding protein that functions as a transcription and translation regulator. It is involved in mRNA splicing, stability, and export, and plays a role in cell proliferation, differentiation, and stress response.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-324 aa (full length)
• Conjugation/Label: Biotin
• Description: Y-box binding protein 1 (YBX1), also known as YB-1, is a highly conserved nucleic acid-binding protein that belongs to the cold shock domain protein family. It functions as a transcription factor regulating the expression of genes involved in cell proliferation, drug resistance, and apoptosis. YBX1 is overexpressed in many cancers and is associated with poor prognosis. It shuttles between the nucleus and cytoplasm, participating in mRNA splicing, stabilization, and translation initiation. YBX1 also interacts with microRNAs and is implicated in epithelial-mesenchymal transition (EMT).
• Form: Liquid
• Molecular Mass: 39 kDa (calculated)
• AASequence: MADPNQDFKKLVLGKPGGTSATAWAQPKRDNPNRRPFGGSSPSRRGYGDSRPAYGPPAYGSGGPPPTGYGGPPAGGYGPGGYGNQQNQYGGPAGGFGGGSRAQAYGPGGFGGQQPFGGQQPGFQQGPGGYRQQPQYGNYYGQQGGFGAQPKYGGPKYGDGPFGGSRGSPSGGYGGRGYGGTPGSGPYGQQGGYGGQPGGFGNQPKYGGPQYGDQPYGGQQSGPYGGRGYGGNPGSQPYGQQGGFGGTPGGFGNQQKYGNPKYGDAPYGGSSSSYSRPQNQYGGQQRGGFGGTPGAFGNQQKYGDPTQGPPQGYGSSSYPQNQYGGAPPGGYGQRGYSGGAPGFQGPKQQSGGQQPGGYGGDPQYGGGSGGYGNQPKYGGPKYGGAPYGGQQRGAFGAPRQYSPAGGYGGRGYGGPPGYGQQGGFGGMPGGF
• Purity: >90% by SDS-PAGE
• Storage: Store at -20 to -80C. Aliquot for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.28 mg/ml (BCA assay)
• Storage Buffer: Sterile PBS, pH 7.4
• Labeling Efficiency: 0.25 by HABA

Gene Information

• Gene Name: YBX1
• Official Symbol: YBX1
• Synonyms: YB1; BP-8; CSDB; DBPB; YB-1; CBF-A; CSDA2; EFI-A; NSEP1; NSEP-1; MDR-NF1
• Gene ID: 4904
• mRNA Refseq: NM_004559.5
• Protein Refseq: NP_004550.2
• MIM: 154030
• UniProt ID: P67809