Recombinant Human YBX1, His-tagged
| Cat.No. : | YBX1-30136TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 4-364 of Human YB1 with N terminal His tag; 361 amino acids, 64kDa AAA35750.1. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 4-364 a.a. |
| Description : | Y box binding protein 1, officially known as YBX1, but commonly referred to as "YB-1" by researchers, is a human protein. Current research is examining its involvement in cancer, and particularly in the metastasis of cancerous cells or prevention thereof. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 50μl distilled water. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Store at 4°C. Upon reconstitution store at -80oC. |
| Sequences of amino acids : | GPQRALSSPTAAAGLVTITPREEPQLPQPAPVTITATMSS EAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGG LTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRND TKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRN YQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPP YYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPV RQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQG QQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAE NSSAPEAEQGGAE |
| Sequence Similarities : | Contains 1 CSD (cold-shock) domain. |
| Gene Name | YBX1 Y box binding protein 1 [ Homo sapiens ] |
| Official Symbol | YBX1 |
| Synonyms | YBX1; Y box binding protein 1; NSEP1, nuclease sensitive element binding protein 1; nuclease-sensitive element-binding protein 1; BP 8; CSDA2; CSDB; DBPB; MDR NF1; NSEP 1; YB 1; YB1; |
| Gene ID | 4904 |
| mRNA Refseq | NM_004559 |
| Protein Refseq | NP_004550 |
| MIM | 154030 |
| Uniprot ID | P67809 |
| Chromosome Location | 1p34 |
| Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; IL-2 Signaling Pathway, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; SIDS Susceptibility Pathways, organism-specific biosystem; |
| Function | DNA binding; DNA binding; RNA binding; RNA binding; double-stranded DNA binding; |
| ◆ Recombinant Proteins | ||
| YBX1-6926H | Recombinant Human YBX1, MYC/DDK-tagged | +Inquiry |
| YBX1-3763H | Recombinant Human YBX1, GST-tagged | +Inquiry |
| YBX1-10250M | Recombinant Mouse YBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| YBX1-553HF | Recombinant Full Length Human YBX1 Protein, GST-tagged | +Inquiry |
| YBX1-6756Z | Recombinant Zebrafish YBX1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| YBX1-1945HCL | Recombinant Human YBX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YBX1 Products
Required fields are marked with *
My Review for All YBX1 Products
Required fields are marked with *
