Recombinant Full Length Human YBX3 Protein, Flag-tagged, Biotinylated

• Cat.No.: YBX3-155HB
• Product Overview: This YBX3 protein is a recombinant full-length human protein expressed in HEK293 cells with MYC/DDK tag at the N-terminus and biotinylated.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-372 aa (full length)
• Conjugation/Label: Biotin
• Description: Y-box-binding protein 3 (YBX3), also known as Cold shock domain-containing protein A (CSDA) or DNA-binding protein A (DBPA), is an RNA-binding protein that participates in 3'-UTR-mediated mRNA stabilization, positive regulation of cytoplasmic translation, and negative regulation of apoptotic process. It is implicated in various cancers including clear cell renal cell carcinoma, colon cancer, and bladder cancer.
• Form: Liquid
• Molecular Mass: 44 kDa (calculated)
• AASequence: MSEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: >60% by SDS-PAGE
• Storage: Store at -20 to -80C. Aliquot for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.45 mg/ml (BCA assay)
• Storage Buffer: Sterile PBS, pH 7.4, 10% glycerol
• Labeling Efficiency: 2.17 by HABA

Gene Information

• Gene Name: YBX3
• Official Symbol: YBX3
• Synonyms: CSDA; DBPA; CSDA1; ZONAB; Y-box-binding protein 3; Cold shock domain-containing protein A; DNA-binding protein A
• Gene ID: 8531
• mRNA Refseq: NM_003651.5
• Protein Refseq: NP_003642.3
• MIM: 603437
• UniProt ID: P16989