Recombinant Full Length Human YBX3 Protein, His&MYC-tagged

• Cat.No.: YBX3-1957HF
• Product Overview: Recombinant Full Length Human YBX3 Protein(P16989)(2-372aa), fused with N-terminal His tag and C-terminal MYC tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His&Myc
• Protein Length: 2-372aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Molecular Mass: 45.1 kDa
• AASequence: SEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: YBX3 Y-box binding protein 3 [ Homo sapiens (human) ]
• Official Symbol: YBX3
• Synonyms: YBX3; Y-box binding protein 3; CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA
• mRNA Refseq: NM_001145426
• Protein Refseq: NP_001138898
• MIM: 603437
• UniProt ID: P16989
• Gene ID: 8531