Recombinant Full Length Human YBX3 Protein, His&MYC-tagged
Cat.No. : | YBX3-1957HF |
Product Overview : | Recombinant Full Length Human YBX3 Protein(P16989)(2-372aa), fused with N-terminal His tag and C-terminal MYC tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His&Myc |
Protein Length : | 2-372aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
Molecular Mass : | 45.1 kDa |
AASequence : | SEAGEATTTTTTTLPQAPTEAAAAAPQDPAPKSPVGSGAPQAAAPAPAAHVAGNPGGDAAPAATGTAAAASLATAAGSEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPTYRPRYRSRGPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNAPSQDGKEAKAGEAPTENPAPPTQQSSAE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | YBX3 Y-box binding protein 3 [ Homo sapiens (human) ] |
Official Symbol | YBX3 |
Synonyms | YBX3; Y-box binding protein 3; CSDA; cold shock domain protein A; DNA-binding protein A; cold shock domain containing A1; CSDA1; dbpA; ZONAB; cold-shock domain protein A; cold-shock domain containing A1; cold shock domain-containing protein A; single-strand DNA-binding protein NF-GMB; ZO-1-associated nucleic acid-binding protein; DBPA |
mRNA Refseq | NM_001145426 |
Protein Refseq | NP_001138898 |
MIM | 603437 |
UniProt ID | P16989 |
Gene ID | 8531 |
◆ Recombinant Proteins | ||
YBX3-6957C | Recombinant Chicken YBX3 | +Inquiry |
Ybx3-7030M | Recombinant Mouse Ybx3 Protein, Myc/DDK-tagged | +Inquiry |
YBX3-155H | Recombinant Human CSDA Protein, MYC/DDK-tagged | +Inquiry |
YBX3-2150HF | Recombinant Full Length Human YBX3 Protein, GST-tagged | +Inquiry |
YBX3-1957HF | Recombinant Full Length Human YBX3 Protein, His&MYC-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YBX3 Products
Required fields are marked with *
My Review for All YBX3 Products
Required fields are marked with *