Recombinant Full Length Human ZAP70 Protein, C-Flag-tagged
Cat.No. : | ZAP70-885HFL |
Product Overview : | Recombinant Full Length Human ZAP70 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme belonging to the protein tyrosine kinase family, and it plays a role in T-cell development and lymphocyte activation. This enzyme, which is phosphorylated on tyrosine residues upon T-cell antigen receptor (TCR) stimulation, functions in the initial step of TCR-mediated signal transduction in combination with the Src family kinases, Lck and Fyn. This enzyme is also essential for thymocyte development. Mutations in this gene cause selective T-cell defect, a severe combined immunodeficiency disease characterized by a selective absence of CD8-positive T-cells. Two transcript variants that encode different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.7 kDa |
AA Sequence : | MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYA IAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQ AIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYH YLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHP QRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFG SVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDFGLSKALGADD SYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPYKKMKGPEVMAFIEQGKRMEC PPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSLASKVEGPPGSTQKAEAACASGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Natural killer cell mediated cytotoxicity, Primary immunodeficiency, T cell receptor signaling pathway |
Full Length : | Full L. |
Gene Name | ZAP70 zeta chain of T cell receptor associated protein kinase 70 [ Homo sapiens (human) ] |
Official Symbol | ZAP70 |
Synonyms | SRK; STD; TZK; STCD; IMD48; ADMIO2; ZAP-70 |
Gene ID | 7535 |
mRNA Refseq | NM_001079.4 |
Protein Refseq | NP_001070.2 |
MIM | 176947 |
UniProt ID | P43403 |
◆ Recombinant Proteins | ||
ZAP70-10274M | Recombinant Mouse ZAP70 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZAP70-1511H | Active Recombinant Human ZAP70 Protein, GST-tagged | +Inquiry |
ZAP70-98H | Recombinant Human Zeta-chain (TCR) Associated Protein Kinase 70kDa | +Inquiry |
ZAP70-458H | Recombinant Human ZAP70, GST-tagged, Active | +Inquiry |
ZAP70-885HFL | Recombinant Full Length Human ZAP70 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZAP70-1948HCL | Recombinant Human ZAP70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZAP70 Products
Required fields are marked with *
My Review for All ZAP70 Products
Required fields are marked with *
0
Inquiry Basket