Recombinant Full Length Human ZC2HC1A Protein, GST-tagged
| Cat.No. : | ZC2HC1A-3799HF |
| Product Overview : | Human C8orf70 full-length ORF ( ENSP00000263849, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 325 amino acids |
| Description : | ZC2HC1A (Zinc Finger C2HC-Type Containing 1A) is a Protein Coding gene. An important paralog of this gene is ZC2HC1B. |
| Molecular Mass : | 61.5 kDa |
| AA Sequence : | MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ZC2HC1A zinc finger C2HC-type containing 1A [ Homo sapiens (human) ] |
| Official Symbol | ZC2HC1A |
| Synonyms | FAM164A; ZC2HC1A; zinc finger C2HC-type containing 1A; CGI-62; C8orf70; FAM164A; zinc finger C2HC domain-containing protein 1A; family with sequence similarity 164, member A; protein FAM164A |
| Gene ID | 51101 |
| mRNA Refseq | NM_016010 |
| Protein Refseq | NP_057094 |
| UniProt ID | Q96GY0 |
| ◆ Recombinant Proteins | ||
| ZC2HC1A-2111H | Recombinant Human ZC2HC1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Zc2hc1a-7056M | Recombinant Mouse Zc2hc1a Protein, Myc/DDK-tagged | +Inquiry |
| ZC2HC1A-4318H | Recombinant Human ZC2HC1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ZC2HC1A-10078Z | Recombinant Zebrafish ZC2HC1A | +Inquiry |
| ZC2HC1A-3799HF | Recombinant Full Length Human ZC2HC1A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZC2HC1A Products
Required fields are marked with *
My Review for All ZC2HC1A Products
Required fields are marked with *
