Recombinant Full Length Human ZC2HC1A Protein, GST-tagged

Cat.No. : ZC2HC1A-3799HF
Product Overview : Human C8orf70 full-length ORF ( ENSP00000263849, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 325 amino acids
Description : ZC2HC1A (Zinc Finger C2HC-Type Containing 1A) is a Protein Coding gene. An important paralog of this gene is ZC2HC1B.
Molecular Mass : 61.5 kDa
AA Sequence : MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSTDTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMIL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZC2HC1A zinc finger C2HC-type containing 1A [ Homo sapiens (human) ]
Official Symbol ZC2HC1A
Synonyms FAM164A; ZC2HC1A; zinc finger C2HC-type containing 1A; CGI-62; C8orf70; FAM164A; zinc finger C2HC domain-containing protein 1A; family with sequence similarity 164, member A; protein FAM164A
Gene ID 51101
mRNA Refseq NM_016010
Protein Refseq NP_057094
UniProt ID Q96GY0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZC2HC1A Products

Required fields are marked with *

My Review for All ZC2HC1A Products

Required fields are marked with *

0
cart-icon