Recombinant Human ZC2HC1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ZC2HC1A-2111H
Product Overview : FAM164A MS Standard C13 and N15-labeled recombinant protein (NP_057094) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the ZC2HC1 family.
Molecular Mass : 35.1 kDa
AA Sequence : MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSADTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ZC2HC1A zinc finger C2HC-type containing 1A [ Homo sapiens (human) ]
Official Symbol ZC2HC1A
Synonyms ZC2HC1A; zinc finger C2HC-type containing 1A; CGI-62; C8orf70; FAM164A; zinc finger C2HC domain-containing protein 1A; family with sequence similarity 164, member A; protein FAM164A
Gene ID 51101
mRNA Refseq NM_016010
Protein Refseq NP_057094
UniProt ID Q96GY0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZC2HC1A Products

Required fields are marked with *

My Review for All ZC2HC1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon