Recombinant Human ZC2HC1A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ZC2HC1A-2111H
• Product Overview: FAM164A MS Standard C13 and N15-labeled recombinant protein (NP_057094) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Belongs to the ZC2HC1 family.
• Molecular Mass: 35.1 kDa
• AA Sequence: MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSADTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMILTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ZC2HC1A zinc finger C2HC-type containing 1A [ Homo sapiens (human) ]
• Official Symbol: ZC2HC1A
• Synonyms: ZC2HC1A; zinc finger C2HC-type containing 1A; CGI-62; C8orf70; FAM164A; zinc finger C2HC domain-containing protein 1A; family with sequence similarity 164, member A; protein FAM164A
• Gene ID: 51101
• mRNA Refseq: NM_016010
• Protein Refseq: NP_057094
• UniProt ID: Q96GY0