Recombinant Human ZC2HC1A Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ZC2HC1A-2111H |
Product Overview : | FAM164A MS Standard C13 and N15-labeled recombinant protein (NP_057094) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the ZC2HC1 family. |
Molecular Mass : | 35.1 kDa |
AA Sequence : | MEGLEENGGVVQVGELLPCKICGRTFFPVALKKHGPICQKTATKKRKTFDSSRQRAEGTDIPTVKPLKPRPEPPKKPSNWRRKHEEFIATIRAAKGLDQALKEGGKLPPPPPPSYDPDYIQCPYCQRRFNENAADRHINFCKEQAARISNKGKFSADTKGKPTSRTQVYKPPALKKSNSPGTASSGSSRLPQPSGAGKTVVGVPSGKVSSSSSSLGNKLQTLSPSHKGIAAPHAGANVKPRNSTPPSLARNPAPGVLTNKRKTYTESYIARPDGDCASSLNGGNIKGIEGHSPGNLPKFCHECGTKYPVEWAKFCCECGIRRMILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ZC2HC1A zinc finger C2HC-type containing 1A [ Homo sapiens (human) ] |
Official Symbol | ZC2HC1A |
Synonyms | ZC2HC1A; zinc finger C2HC-type containing 1A; CGI-62; C8orf70; FAM164A; zinc finger C2HC domain-containing protein 1A; family with sequence similarity 164, member A; protein FAM164A |
Gene ID | 51101 |
mRNA Refseq | NM_016010 |
Protein Refseq | NP_057094 |
UniProt ID | Q96GY0 |
◆ Recombinant Proteins | ||
ZC2HC1A-5160H | Recombinant Human ZC2HC1A Protein, GST-tagged | +Inquiry |
ZC2HC1A-2111H | Recombinant Human ZC2HC1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZC2HC1A-3799HF | Recombinant Full Length Human ZC2HC1A Protein, GST-tagged | +Inquiry |
Zc2hc1a-7056M | Recombinant Mouse Zc2hc1a Protein, Myc/DDK-tagged | +Inquiry |
ZC2HC1A-1840H | Recombinant Human ZC2HC1A | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZC2HC1A Products
Required fields are marked with *
My Review for All ZC2HC1A Products
Required fields are marked with *