Recombinant Full Length Human ZC2HC1C Protein, GST-tagged
Cat.No. : | ZC2HC1C-4531HF |
Product Overview : | Human FAM164C full-length ORF ( NP_001035895.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 275 amino acids |
Description : | ZC2HC1C (Zinc Finger C2HC-Type Containing 1C) is a Protein Coding gene. An important paralog of this gene is ZC2HC1B. |
Molecular Mass : | 57.4 kDa |
AA Sequence : | MAGLQRLASHLPVGVMLPHNTTEAPGPHSAKQDSYEQGDSSQQSLKGHLRNNFQKQLLSNKELILDKVYTHPKWNTQTKARSYSYPHCTGISQQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLKPMVHRKSCSTGEAGTDGDHNVYPRPPEPREFSSRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQKEQAKENENGELQKIILPRSRVKG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ZC2HC1C zinc finger C2HC-type containing 1C [ Homo sapiens (human) ] |
Official Symbol | ZC2HC1C |
Synonyms | ZC2HC1C; zinc finger C2HC-type containing 1C; Zinc Finger C2HC-Type Containing 1C; Family With Sequence Similarity 164, Member C; C14orf140; FAM164C; Zinc Finger C2HC Domain-Containing Protein 1C; Chromosome 14 Open Reading Frame 140; Protein FAM164C; zinc finger C2HC domain-containing protein 1C; family with sequence similarity 164, member C; protein FAM164C |
Gene ID | 79696 |
mRNA Refseq | NM_001042430 |
Protein Refseq | NP_001035895 |
UniProt ID | Q53FD0 |
◆ Recombinant Proteins | ||
ZC2HC1C-837C | Recombinant Cynomolgus Monkey ZC2HC1C Protein, His (Fc)-Avi-tagged | +Inquiry |
Zc2hc1c-7058M | Recombinant Mouse Zc2hc1c Protein, Myc/DDK-tagged | +Inquiry |
ZC2HC1C-6306R | Recombinant Rat ZC2HC1C Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC2HC1C-1094C | Recombinant Cynomolgus ZC2HC1C Protein, His-tagged | +Inquiry |
ZC2HC1C-6650R | Recombinant Rat ZC2HC1C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZC2HC1C Products
Required fields are marked with *
My Review for All ZC2HC1C Products
Required fields are marked with *