Recombinant Full Length Human ZC3H12A Protein, C-Flag-tagged
Cat.No. : | ZC3H12A-29HFL |
Product Overview : | Recombinant Full Length Human ZC3H12A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | ZC3H12A is an MCP1-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQ KLGVQADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVI DGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVF TPSRRVGGKRVVCYDDRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDP LGRHGPSLDNFLRKKPLTLEHRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPS KDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDW LPQTLDSLPYVSQDCLDSGIGSLESQMSELWGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRA MGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRADSLAKEQASVYTKL CGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSESGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | ZC3H12A zinc finger CCCH-type containing 12A [ Homo sapiens (human) ] |
Official Symbol | ZC3H12A |
Synonyms | Reg1; MCPIP; MCPIP1; MCPIP-1; dJ423B22.1 |
Gene ID | 80149 |
mRNA Refseq | NM_025079.3 |
Protein Refseq | NP_079355.2 |
MIM | 610562 |
UniProt ID | Q5D1E8 |
◆ Recombinant Proteins | ||
Zc3h12a-7059M | Recombinant Mouse Zc3h12a Protein, Myc/DDK-tagged | +Inquiry |
ZC3H12A-10293M | Recombinant Mouse ZC3H12A Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC3H12A-29HFL | Recombinant Full Length Human ZC3H12A Protein, C-Flag-tagged | +Inquiry |
ZC3H12A-6307R | Recombinant Rat ZC3H12A Protein, His (Fc)-Avi-tagged | +Inquiry |
ZC3H12A-6604H | Recombinant Human ZC3H12A Protein (Asp426-Glu599), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZC3H12A-745HCL | Recombinant Human ZC3H12A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZC3H12A Products
Required fields are marked with *
My Review for All ZC3H12A Products
Required fields are marked with *
0
Inquiry Basket