Recombinant Full Length Human ZNF747 Protein, GST-tagged
| Cat.No. : | ZNF747-6160HF |
| Product Overview : | Human MGC2474 full-length ORF ( NP_076420.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 191 amino acids |
| Description : | ZNF747 (Zinc Finger Protein 747) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ENSG00000261459. |
| Molecular Mass : | 47 kDa |
| AA Sequence : | MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ZNF747 zinc finger protein 747 [ Homo sapiens ] |
| Official Symbol | ZNF747 |
| Synonyms | ZNF747; zinc finger protein 747; KRAB domain-containing protein ZNF747; MGC2474; |
| Gene ID | 65988 |
| mRNA Refseq | NM_023931 |
| Protein Refseq | NP_076420 |
| UniProt ID | Q9BV97 |
| ◆ Recombinant Proteins | ||
| ZNF747-6160HF | Recombinant Full Length Human ZNF747 Protein, GST-tagged | +Inquiry |
| ZNF747-4341H | Recombinant Human ZNF747 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZNF747-16HCL | Recombinant Human ZNF747 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZNF747 Products
Required fields are marked with *
My Review for All ZNF747 Products
Required fields are marked with *



