Recombinant Human ZNF747 Protein, GST-tagged

Cat.No. : ZNF747-4341H
Product Overview : Human MGC2474 full-length ORF ( NP_076420.1, 1 a.a. - 191 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ZNF747 (Zinc Finger Protein 747) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding. An important paralog of this gene is ENSG00000261459.
Molecular Mass : 47 kDa
AA Sequence : MTDPSLGLTVPMAPPLAPLPPRDPNGAGSEWRKPGAVSFADVAVYFSREEWGCLRPAQRALYRDVMRETYGHLGALGESPTCLPGPCASTGPAAPLGAACGVGGPGAGQAASSQRGVCVLLPQESEAASRRSSPGWRRRPNCGIRLPRIRRWRSVRQKRTQQIPETRKRKDKGKGREPWRSPTLWPPGLLG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZNF747 zinc finger protein 747 [ Homo sapiens ]
Official Symbol ZNF747
Synonyms ZNF747; zinc finger protein 747; KRAB domain-containing protein ZNF747; MGC2474;
Gene ID 65988
mRNA Refseq NM_023931
Protein Refseq NP_076420
UniProt ID Q9BV97

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF747 Products

Required fields are marked with *

My Review for All ZNF747 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon