Recombinant Full Length Macaca Fascicularis Elongation Of Very Long Chain Fatty Acids Protein 4(Elovl4) Protein, His-Tagged
| Cat.No. : | RFL33338MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis Elongation of very long chain fatty acids protein 4(ELOVL4) Protein (Q95K73) (1-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-314) |
| Form : | Lyophilized powder |
| AA Sequence : | MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFV WLGPKWMKDREPFQMRLVLIIYNFGMVLLNFFIFRELFMGSYNAGYSYICQSVDYSNNVN EVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQ AFFGAQMNSFIHVIMYSYYGLAAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTD CPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKTGKTAMNGISANGVSKSEKQLVI ENGKKQKNGKAKGD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ELOVL4 |
| Synonyms | ELOVL4; QtrA-14469; Elongation of very long chain fatty acids protein 4; 3-keto acyl-CoA synthase ELOVL4; ELOVL fatty acid elongase 4; ELOVL FA elongase 4; Very long chain 3-ketoacyl-CoA synthase 4; Very long chain 3-oxoacyl-CoA synthase 4 |
| UniProt ID | Q95K73 |
| ◆ Recombinant Proteins | ||
| ELOVL4-491C | Recombinant Cynomolgus ELOVL4 Protein, His-tagged | +Inquiry |
| ELOVL4-4173C | Recombinant Chicken ELOVL4 | +Inquiry |
| ELOVL4-1277R | Recombinant Rhesus Macaque ELOVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELOVL4-5150M | Recombinant Mouse ELOVL4 Protein | +Inquiry |
| ELOVL4-3262H | Recombinant Human ELOVL4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOVL4 Products
Required fields are marked with *
My Review for All ELOVL4 Products
Required fields are marked with *




