Recombinant Human ELOVL4 Protein, GST-tagged
Cat.No. : | ELOVL4-3262H |
Product Overview : | Human ELOVL4 partial ORF ( NP_073563, 99 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 31.9 kDa |
AA Sequence : | MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELOVL4 ELOVL fatty acid elongase 4 [ Homo sapiens ] |
Official Symbol | ELOVL4 |
Synonyms | ELOVL4; ELOVL fatty acid elongase 4; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 4 , STGD2, STGD3; elongation of very long chain fatty acids protein 4; cancer/testis antigen 118; CT118; ELOVL FA elongase 4; 3-keto acyl-CoA synthase ELOVL4; Stargardt disease 3 (autosomal dominant); elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4; ADMD; ISQMR; STGD2; STGD3; FLJ17667; FLJ92876; |
Gene ID | 6785 |
mRNA Refseq | NM_022726 |
Protein Refseq | NP_073563 |
MIM | 605512 |
UniProt ID | Q9GZR5 |
◆ Recombinant Proteins | ||
ELOVL4-2752M | Recombinant Mouse ELOVL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELOVL4-491C | Recombinant Cynomolgus ELOVL4 Protein, His-tagged | +Inquiry |
ELOVL4-1453R | Recombinant Rhesus monkey ELOVL4 Protein, His-tagged | +Inquiry |
ELOVL4-5150M | Recombinant Mouse ELOVL4 Protein | +Inquiry |
RFL21207MF | Recombinant Full Length Macaca Mulatta Elongation Of Very Long Chain Fatty Acids Protein 4(Elovl4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELOVL4 Products
Required fields are marked with *
My Review for All ELOVL4 Products
Required fields are marked with *