Recombinant Human ELOVL4 Protein, GST-tagged

Cat.No. : ELOVL4-3262H
Product Overview : Human ELOVL4 partial ORF ( NP_073563, 99 a.a. - 154 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a membrane-bound protein which is a member of the ELO family, proteins which participate in the biosynthesis of fatty acids. Consistent with the expression of the encoded protein in photoreceptor cells of the retina, mutations and small deletions in this gene are associated with Stargardt-like macular dystrophy (STGD3) and autosomal dominant Stargardt-like macular dystrophy (ADMD), also referred to as autosomal dominant atrophic macular degeneration. [provided by RefSeq, Jul 2008]
Molecular Mass : 31.9 kDa
AA Sequence : MGSYNAGYSYICQSVDYSNNVHEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELOVL4 ELOVL fatty acid elongase 4 [ Homo sapiens ]
Official Symbol ELOVL4
Synonyms ELOVL4; ELOVL fatty acid elongase 4; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast) like 4 , STGD2, STGD3; elongation of very long chain fatty acids protein 4; cancer/testis antigen 118; CT118; ELOVL FA elongase 4; 3-keto acyl-CoA synthase ELOVL4; Stargardt disease 3 (autosomal dominant); elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4; ADMD; ISQMR; STGD2; STGD3; FLJ17667; FLJ92876;
Gene ID 6785
mRNA Refseq NM_022726
Protein Refseq NP_073563
MIM 605512
UniProt ID Q9GZR5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELOVL4 Products

Required fields are marked with *

My Review for All ELOVL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon