Recombinant Full Length Macaca Fascicularis Lysophosphatidic Acid Receptor 2(Lpar2) Protein, His-Tagged
Cat.No. : | RFL5762MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Lysophosphatidic acid receptor 2(LPAR2) Protein (Q95KH4) (1-351aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-351) |
Form : | Lyophilized powder |
AA Sequence : | MVTMGHCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA TLLAIAVERRRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV KTVVIILGAFVVCWTPGQVVLLLDGLGCKSCNVLAVEKYFLLLAEANSLVNAAVYSCRDA EMRRTFRRLLCCACLRRSTRESAHYTSSAQGGASTRIMLPENGHPLMDSTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LPAR2 |
Synonyms | LPAR2; EDG4; LPA2; QtrA-12246; Lysophosphatidic acid receptor 2; LPA receptor 2; LPA-2; Lysophosphatidic acid receptor Edg-4 |
UniProt ID | Q95KH4 |
◆ Recombinant Proteins | ||
RFL5762MF | Recombinant Full Length Macaca Fascicularis Lysophosphatidic Acid Receptor 2(Lpar2) Protein, His-Tagged | +Inquiry |
LPAR2-3830C | Recombinant Chicken LPAR2 | +Inquiry |
LPAR2-4021H | Recombinant Human LPAR2 Protein, GST-tagged | +Inquiry |
LPAR2-5968HF | Recombinant Full Length Human LPAR2 Protein | +Inquiry |
LPAR2-4692HF | Recombinant Full Length Human LPAR2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LPAR2-4674HCL | Recombinant Human LPAR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LPAR2 Products
Required fields are marked with *
My Review for All LPAR2 Products
Required fields are marked with *