Recombinant Full Length Macaca Fascicularis Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13(Ndufa13) Protein, His-Tagged
Cat.No. : | RFL9685MF |
Product Overview : | Recombinant Full Length Macaca fascicularis NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13) Protein (Q4R6H1) (1-163aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-163) |
Form : | Lyophilized powder |
AA Sequence : | MAVAVCHFRLGPEVWNTASMEMPKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIG TLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDV PDWKVGESVFHTTRWVPPLIGELYGLRTTEETIHANYGFMWYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NDUFA13 |
Synonyms | NDUFA13; QtsA-18051; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Complex I-B16.6; CI-B16.6; NADH-ubiquinone oxidoreductase B16.6 subunit |
UniProt ID | Q4R6H1 |
◆ Recombinant Proteins | ||
NDUFA13-732C | Recombinant Cynomolgus NDUFA13 Protein, His-tagged | +Inquiry |
NDUFA13-5663HF | Recombinant Full Length Human NDUFA13 Protein, GST-tagged | +Inquiry |
NDUFA13-5342H | Recombinant Human NDUFA13 Protein, GST-tagged | +Inquiry |
NDUFA13-10514M | Recombinant Mouse NDUFA13 Protein | +Inquiry |
RFL9685MF | Recombinant Full Length Macaca Fascicularis Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13(Ndufa13) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NDUFA13 Products
Required fields are marked with *
My Review for All NDUFA13 Products
Required fields are marked with *
0
Inquiry Basket