Recombinant Full Length Bovine Nadh Dehydrogenase [Ubiquinone] 1 Alpha Subcomplex Subunit 13(Ndufa13) Protein, His-Tagged
Cat.No. : | RFL11973BF |
Product Overview : | Recombinant Full Length Bovine NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13(NDUFA13) Protein (Q95KV7) (2-144aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-144) |
Form : | Lyophilized powder |
AA Sequence : | AASKVKQDMPPVGGYGPIDYKRNLPRRGLSGYSMFAVGIGALLFGYWSMMKWNRERRRLQ IEDFEARIALMPLLQAEKDRRVLQMLRENLEEEATVMKDVPGWKVGESVFHTTRWVTPMM GELYGLRASEEVLSATYGFIWYT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NDUFA13 |
Synonyms | NDUFA13; GRIM19; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; Cell death regulatory protein GRIM-19; Complex I-B16.6; CI-B16.6; Gene associated with retinoic-interferon-induced mortality 19 protein; GRIM-19; NADH-ubiquinone oxidoreductas |
UniProt ID | Q95KV7 |
◆ Cell & Tissue Lysates | ||
NDUFA13-3922HCL | Recombinant Human NDUFA13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NDUFA13 Products
Required fields are marked with *
My Review for All NDUFA13 Products
Required fields are marked with *
0
Inquiry Basket