Recombinant Full Length Macaca Fascicularis Natural Cytotoxicity Triggering Receptor 3(Ncr3) Protein, His-Tagged
| Cat.No. : | RFL27154MF |
| Product Overview : | Recombinant Full Length Macaca fascicularis Natural cytotoxicity triggering receptor 3(NCR3) Protein (P61483) (19-176aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Macaca fascicularis |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (19-176) |
| Form : | Lyophilized powder |
| AA Sequence : | LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLGAGTVLLLRAGFYAVSFLSVAVGSTLYYQGKCHCHMGTHCHS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | NCR3 |
| Synonyms | NCR3; Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein; NK-p30; NKp30; CD antigen CD337 |
| UniProt ID | P61483 |
| ◆ Recombinant Proteins | ||
| NCR3-0563H | Active Recombinant Human NCR3 protein, lFc-tagged | +Inquiry |
| NCR3-044H | Recombinant Human NCR3 Protein, C-His-tagged | +Inquiry |
| NCR3-814H | Recombinant Human NCR3 protein, Fc-tagged | +Inquiry |
| NCR3-197H | Recombinant Human NCR3 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| NCR3-664H | Recombinant Human NCR3 Protein (Leu19-Glu135), C-hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NCR3-2652HCL | Recombinant Human NCR3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCR3 Products
Required fields are marked with *
My Review for All NCR3 Products
Required fields are marked with *



