Recombinant Full Length Macaca Fascicularis Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged
Cat.No. : | RFL3887MF |
Product Overview : | Recombinant Full Length Macaca fascicularis Protein tweety homolog 1(TTYH1) Protein (Q9MZZ8) (1-450aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca fascicularis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-450) |
Form : | Lyophilized powder |
AA Sequence : | MGAPPGYRPSAWVHLLHQLPRADFQLRPVPSGFAPQEQEYQQALLLVAALAGLGLGLSLI FIAVYLIRFCCCRPPEPPGSKTPSPGGGCVTWSCIVALLAGCIGIGIGFYGNSETSDGVS QLSSALLHANHTLSAIDHLVLETVERLGEAVRTELTTLEEVLEPRTELVAAARGARRQAE AVAQQLQGLAFWQGVPLSPLQVAEDVSFVEEYRWLAYVLLLLLELLVCLFTLLGLAKQSK WLVIVMTVMSLLVLVLSWGSMGLEAATAVGLSDFYSNPDPYVLNLTQEETGLSSDILSYY FLCNQAVSNPFQQRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGN FHQLVALLHCRGLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCSLPRAWALF PPSDDYDDTDDDDPFNPQESKRFVQWQSSI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TTYH1 |
Synonyms | TTYH1; QccE-16395; QccE-16959; Protein tweety homolog 1 |
UniProt ID | Q9MZZ8 |
◆ Recombinant Proteins | ||
TTYH1-8555H | Recombinant Human TTYH1 protein, GST-tagged | +Inquiry |
TTYH1-8556H | Recombinant Human TTYH1 protein, His-tagged | +Inquiry |
TTYH1-1060C | Recombinant Cynomolgus TTYH1 Protein, His-tagged | +Inquiry |
TTYH1-17604M | Recombinant Mouse TTYH1 Protein | +Inquiry |
RFL1252MF | Recombinant Full Length Mouse Protein Tweety Homolog 1(Ttyh1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TTYH1-1860HCL | Recombinant Human TTYH1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TTYH1 Products
Required fields are marked with *
My Review for All TTYH1 Products
Required fields are marked with *
0
Inquiry Basket