Recombinant Full Length Macaca Mulatta Leukocyte-Specific Transcript 1 Protein(Lst1) Protein, His-Tagged
Cat.No. : | RFL28040MF |
Product Overview : | Recombinant Full Length Macaca mulatta Leukocyte-specific transcript 1 protein(LST1) Protein (Q5TM23) (1-93aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-93) |
Form : | Lyophilized powder |
AA Sequence : | MIHVYTSTGAWGWAGSCCWLWSFCPPACIGCIEEHLLSWPQVQGSSEQEIHYASLQRLPV SSSEGPDLRDRDKRGTKEDPRADYACIAENKPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LST1 |
Synonyms | LST1; Leukocyte-specific transcript 1 protein |
UniProt ID | Q5TM23 |
◆ Recombinant Proteins | ||
LST1-618HF | Recombinant Full Length Human LST1 Protein, GST-tagged | +Inquiry |
LST1-3186H | Recombinant Human LST1 protein, His-tagged | +Inquiry |
LST1-2408R | Recombinant Rhesus Macaque LST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LST1-661H | Recombinant Human LST1, GST-tagged | +Inquiry |
LST1-12H | Recombinant Human LST1 protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LST1-9168HCL | Recombinant Human LST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LST1 Products
Required fields are marked with *
My Review for All LST1 Products
Required fields are marked with *