Recombinant Human LST1 protein, GST-tagged

• Cat.No.: LST1-662H
• Product Overview: Recombinant Human LST1(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 118 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.8 kDa
• AA Sequence: MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQSRNSTMHLCRGCQCPAVRDLTSGAE TREAPRRIQELTMPALLRTNPPEHPRHLPQPRRVDRVPLWSSQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: LST1 Leukocyte-specific transcript 1 [ Homo sapiens ]
• Official Symbol: LST1
• Synonyms: LST1; Leukocyte-specific transcript 1
• Gene ID: 7940
• mRNA Refseq: NM_007161
• Protein Refseq: NP_009092
• MIM: 109170
• UniProt ID: O00453
• Chromosome Location: 6p21.3