Recombinant Human LST1 protein, GST-tagged
| Cat.No. : | LST1-662H |
| Product Overview : | Recombinant Human LST1(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 118 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 39.8 kDa |
| AA Sequence : | MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQSRNSTMHLCRGCQCPAVRDLTSGAE TREAPRRIQELTMPALLRTNPPEHPRHLPQPRRVDRVPLWSSQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | LST1 Leukocyte-specific transcript 1 [ Homo sapiens ] |
| Official Symbol | LST1 |
| Synonyms | LST1; Leukocyte-specific transcript 1; |
| Gene ID | 7940 |
| mRNA Refseq | NM_007161 |
| Protein Refseq | NP_009092 |
| MIM | 109170 |
| UniProt ID | O00453 |
| Chromosome Location | 6p21.3 |
| ◆ Recombinant Proteins | ||
| LST1-663H | Recombinant Human LST1 protein, MYC/DDK-tagged | +Inquiry |
| RFL28040MF | Recombinant Full Length Macaca Mulatta Leukocyte-Specific Transcript 1 Protein(Lst1) Protein, His-Tagged | +Inquiry |
| LST1-618HF | Recombinant Full Length Human LST1 Protein, GST-tagged | +Inquiry |
| LST1-12H | Recombinant Human LST1 protein, MYC/DDK-tagged | +Inquiry |
| LST1-661H | Recombinant Human LST1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LST1-9168HCL | Recombinant Human LST1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LST1 Products
Required fields are marked with *
My Review for All LST1 Products
Required fields are marked with *
