Recombinant Human LST1 protein, GST-tagged

Cat.No. : LST1-662H
Product Overview : Recombinant Human LST1(1 a.a. - 118 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 118 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 39.8 kDa
AA Sequence : MLSRNDDICIYGGLGLGGLLLLAVVLLSACLCWLHRRVKRLERSWPRAPQSRNSTMHLCRGCQCPAVRDLTSGAE TREAPRRIQELTMPALLRTNPPEHPRHLPQPRRVDRVPLWSSQ
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name LST1 Leukocyte-specific transcript 1 [ Homo sapiens ]
Official Symbol LST1
Synonyms LST1; Leukocyte-specific transcript 1;
Gene ID 7940
mRNA Refseq NM_007161
Protein Refseq NP_009092
MIM 109170
UniProt ID O00453
Chromosome Location 6p21.3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LST1 Products

Required fields are marked with *

My Review for All LST1 Products

Required fields are marked with *

0
cart-icon
0
compare icon