Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Beta-1 Adrenergic Receptor(Adrb1) Protein, His-Tagged
Cat.No. : | RFL-9732MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) Beta-1 adrenergic receptor(ADRB1) Protein (P47899) (1-480aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-480) |
Form : | Lyophilized powder |
AA Sequence : | MGAGALVLGASEPGNLSSAAPLPDGVATAARLLVPASPPASLLPPASEGPEPLSQQWTAG MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPSPSPVPAPPPGPPRPAAAAAT TAPLVNGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDR LFVFFNWLGYANSAFNPIIYCRSPDFRNAFQRLLCCARRAARRRHAAHGDRPRASGCLAR PGPPPSPGAASDDDDDDVVGATQPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADRB1 |
Synonyms | ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor |
UniProt ID | P47899 |
◆ Recombinant Proteins | ||
RFL7354FF | Recombinant Full Length Cat Beta-1 Adrenergic Receptor(Adrb1) Protein, His-Tagged | +Inquiry |
ADRB1-544R | Recombinant Rat ADRB1 Protein | +Inquiry |
ADRB1-01H | Recombinant Human ADRB1 Protein, His-tagged | +Inquiry |
ADRB1-1319H | Recombinant Human ADRB1 Protein (378-477 aa), His-tagged | +Inquiry |
RFL28316SF | Recombinant Full Length Pig Beta-1 Adrenergic Receptor(Adrb1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADRB1 Products
Required fields are marked with *
My Review for All ADRB1 Products
Required fields are marked with *
0
Inquiry Basket