Recombinant Full Length Macaca Mulatta (Rhesus Macaque) Cd226 Antigen(Cd226) Protein, His-Tagged
Cat.No. : | RFL4722MF |
Product Overview : | Recombinant Full Length Macaca mulatta (Rhesus macaque) CD226 antigen(CD226) Protein (O18906) (19-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (19-336) |
Form : | Lyophilized powder |
AA Sequence : | EEVLWHTSVPFAENMSLECVYPSVGILTQVEWFKIGTEKDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDGFEAAVPPNSHIVSEPGKNITLTCQPQMTWPVQEVRWEKIQPHQIDLLTYCDLVHGRNFTSKFPRQIVSNCSHGSWSFIVVPDVTASDSGLYRCHLQASAGENETFVMRLTVAEGQTDNQYTRFVTGGTVLLLLFVISITTIIVIFLNRRRRRERSDLYTESWDTQKAPKNYRSPISASQPTNQSMDDTREDIYVNYPTFSRRPKTRV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD226 |
Synonyms | CD226; PTA1; CD226 antigen; Platelet and T-cell activation antigen 1; CD antigen CD226 |
UniProt ID | O18906 |
◆ Recombinant Proteins | ||
Cd226-2056M | Recombinant Mouse Cd226 Protein, Myc/DDK-tagged | +Inquiry |
CD226-636H | Active Recombinant Human CD226 Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
CD226-5128Z | Recombinant Zebrafish CD226 | +Inquiry |
CD226-01H | Recombinant Human CD226 Protein, hIgG-His-Tagged | +Inquiry |
CD226-635H | Recombinant Human CD226 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD226-2645HCL | Recombinant Human CD226 cell lysate | +Inquiry |
CD226-1167CCL | Recombinant Cynomolgus CD226 cell lysate | +Inquiry |
CD226-2800MCL | Recombinant Mouse CD226 cell lysate | +Inquiry |
CD226-1173RCL | Recombinant Rat CD226 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD226 Products
Required fields are marked with *
My Review for All CD226 Products
Required fields are marked with *
0
Inquiry Basket