Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 2(Slc16A7) Protein, His-Tagged
Cat.No. : | RFL8219MF |
Product Overview : | Recombinant Full Length Meriones unguiculatus Monocarboxylate transporter 2(SLC16A7) Protein (O35440) (1-71aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Meriones unguiculatus (Mongolian jird) (Mongolian gerbil) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-71) |
Form : | Lyophilized powder |
AA Sequence : | AFVDMFSRPCGGLIANTRLVRPRIQYFFSLAIVFTGVCHLLCPLAESYTALVVYAIFFGY GFGSVSSILFE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC16A7 |
Synonyms | SLC16A7; MCT2; Monocarboxylate transporter 2; MCT 2; Solute carrier family 16 member 7; Fragment |
UniProt ID | O35440 |
◆ Recombinant Proteins | ||
SLC16A7-15237M | Recombinant Mouse SLC16A7 Protein | +Inquiry |
SLC16A7-2700H | Recombinant Human SLC16A7, His-tagged | +Inquiry |
SLC16A7-3529Z | Recombinant Zebrafish SLC16A7 | +Inquiry |
RFL8219MF | Recombinant Full Length Meriones Unguiculatus Monocarboxylate Transporter 2(Slc16A7) Protein, His-Tagged | +Inquiry |
SLC16A7-4416C | Recombinant Chicken SLC16A7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC16A7 Products
Required fields are marked with *
My Review for All SLC16A7 Products
Required fields are marked with *